GSHMIARIIGEIGIEGARFIEENIDEQFKALRYLSKGIDSETFVKLVIANSLVSYQLTGKGEQWWWEFAKYFYGRDVKSI
YLAYKEFLPNSRFNRRLIPQKLSRIRRVETFLSTLTEERIEEYYGDMSSLWGSIARALGVDKESKTVVFSVKMFGYAARI
VLSTFNPYPMEIPIPEDSRIVKLTKKLTNEKPRKFWMKIARESGVPPLHIDSILWPLLGGASIDSAPPELRDKLAELIKI
IR
The query sequence (length=242) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7oli:A | 242 | 242 | 1.0000 | 1.0000 | 1.0000 | 3.39e-178 | 7oli:B, 7oue:A, 7oue:C, 7oue:E, 7oue:G, 7oy7:A, 7p0w:A, 7p8l:A, 7p9z:A |
2 | 1xqp:A | 252 | 235 | 0.2769 | 0.2659 | 0.2851 | 4.22e-26 | |
3 | 7q4t:AAA | 187 | 53 | 0.0744 | 0.0963 | 0.3396 | 1.6 | |
4 | 7ood:i | 144 | 107 | 0.1033 | 0.1736 | 0.2336 | 3.3 | 7p6z:i, 7pah:i, 7pai:i, 7paj:i, 7pak:i, 7pal:i, 7pam:i, 7pan:i, 7pao:i, 7paq:i, 7par:i, 7pas:i, 7pat:i, 7pau:i, 7ph9:i, 7pha:i, 7phb:i, 7phc:i, 7pi8:i, 7pi9:i, 7pia:i, 7pib:i, 7pic:i, 7pio:i, 7pip:i, 7piq:i, 7pir:i, 7pis:i, 7pit:i |
5 | 8eyi:F | 1211 | 61 | 0.0744 | 0.0149 | 0.2951 | 5.5 | 4w9n:A, 4w9n:B, 4w9n:C, 4w9n:D |
6 | 8dgc:A | 2028 | 61 | 0.0826 | 0.0099 | 0.3279 | 5.8 | 8dgc:B, 8dgc:C, 8dgc:D |
7 | 8eyk:F | 1070 | 61 | 0.0744 | 0.0168 | 0.2951 | 5.8 | |
8 | 8eyk:E | 966 | 61 | 0.0744 | 0.0186 | 0.2951 | 5.9 | 8eyi:E, 8gkc:A, 8gkc:D |
9 | 7mq9:LM | 2005 | 28 | 0.0496 | 0.0060 | 0.4286 | 5.9 | |
10 | 8h1c:B | 983 | 72 | 0.0744 | 0.0183 | 0.2500 | 6.0 | 8h1c:A, 7xjz:A, 7xk0:A, 7xk1:A, 7xk1:C |
11 | 7mqa:LM | 2041 | 28 | 0.0496 | 0.0059 | 0.4286 | 6.0 | |
12 | 1olm:E | 397 | 83 | 0.0661 | 0.0403 | 0.1928 | 6.3 | 1olm:A, 1olm:C, 4omj:A, 4omj:B, 4omk:A, 4omk:B |
13 | 4wt7:A | 294 | 32 | 0.0620 | 0.0510 | 0.4688 | 6.8 | 4wt7:B |
14 | 1epv:A | 382 | 51 | 0.0620 | 0.0393 | 0.2941 | 7.7 | 1bd0:A, 1bd0:B, 1epv:B, 1ftx:A, 1ftx:B, 1l6f:A, 1l6f:B, 1l6g:A, 1l6g:B, 1niu:A, 1niu:B, 1sft:A, 1sft:B, 2sfp:A, 2sfp:B, 1xqk:A, 1xqk:B, 1xql:A, 1xql:B |
15 | 6gej:R | 411 | 22 | 0.0413 | 0.0243 | 0.4545 | 8.9 | 6gen:R |