GSHCDLSLKIPEISIQDMTAQVTSPSGKTHEAEIVEGENHTYCIRFVPAEMGTHTVSVKYKGQHVPGSPFQFTVGPLGEG
GAHKVRAGGPGLERAEAGVPAEFSIWTREAGAGGLAIAVEGPSKAEISFEDRKDGSCGVAYVVQEPGDYEVSVKFNEEHI
PDSPFVVPVASP
The query sequence (length=172) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 4p3w:A | 172 | 171 | 0.9942 | 0.9942 | 1.0000 | 2.86e-124 | 2brq:A, 2brq:B, 3isw:A, 3isw:B, 2jf1:A, 2mtp:A, 4p3w:B, 4p3w:E, 4p3w:F, 4p3w:D, 4p3w:C, 7sft:A, 2w0p:A, 2w0p:B |
2 | 2k9u:A | 119 | 102 | 0.5465 | 0.7899 | 0.9216 | 2.08e-64 | |
3 | 2k9u:A | 119 | 81 | 0.1395 | 0.2017 | 0.2963 | 0.11 | |
4 | 2bp3:A | 91 | 88 | 0.2616 | 0.4945 | 0.5114 | 1.46e-27 | 2bp3:B |
5 | 2bp3:A | 91 | 44 | 0.0930 | 0.1758 | 0.3636 | 0.001 | 2bp3:B |
6 | 4mgx:A | 181 | 84 | 0.2267 | 0.2155 | 0.4643 | 1.08e-16 | |
7 | 4mgx:A | 181 | 129 | 0.2326 | 0.2210 | 0.3101 | 2.50e-08 | |
8 | 4mgx:A | 181 | 55 | 0.0756 | 0.0718 | 0.2364 | 0.30 | |
9 | 6fq3:A | 390 | 97 | 0.1860 | 0.0821 | 0.3299 | 2.13e-05 | 6fql:A |
10 | 6fq3:A | 390 | 65 | 0.1279 | 0.0564 | 0.3385 | 2.29e-05 | 6fql:A |
11 | 1k83:A | 1366 | 102 | 0.1279 | 0.0161 | 0.2157 | 4.5 | 1twa:A, 1twc:A, 1twg:A, 1twh:A |
12 | 7edd:A | 1394 | 55 | 0.1047 | 0.0129 | 0.3273 | 9.1 | 5xyr:A |
13 | 5kbk:A | 157 | 31 | 0.0814 | 0.0892 | 0.4516 | 9.2 | 5kbl:A, 5kbm:A, 4n3t:A, 4n3u:A |
14 | 5xya:A | 1358 | 55 | 0.1047 | 0.0133 | 0.3273 | 9.3 | 5xxz:A |
15 | 5xxz:B | 1310 | 55 | 0.1047 | 0.0137 | 0.3273 | 9.6 |