Home Research COVID-19 Services Publications People Teaching Job Opening News Forum Lab Only
Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

BioLiP
>protein
GSEQTHRAIFRFVPRHEDELELEVDDPLLVELQAEDYWYEAYNMRTGARGVFPAYYAIEVTK

The query sequence (length=62) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

# Hit Hit
length 		Aligned
length 		Identity
(normalized by query) 		Identity
(normalized by hit) 		Identity (normalized
by aligned length) 		E-value Homologs
to hit
1 2fpd:C 62 62 1.0000 1.0000 1.0000 6.73e-42 7nyl:AAA
2 5xhz:A 60 52 0.2903 0.3000 0.3462 4.76e-06 5xhz:B
3 4x1v:A 59 54 0.2581 0.2712 0.2963 1.02e-05 3u23:A
4 2ak5:B 64 55 0.3387 0.3281 0.3818 6.86e-04 2df6:A, 2df6:B
5 1zsg:A 65 54 0.3226 0.3077 0.3704 0.001 2p4r:A, 5sxp:B, 5sxp:D, 5sxp:A, 5sxp:C
6 4f14:A 56 52 0.2581 0.2857 0.3077 0.005
7 6b27:A 118 58 0.2742 0.1441 0.2931 0.010 6b27:B, 6b27:C, 6b27:D, 6b27:E, 6b27:F
8 2bz8:B 57 54 0.2742 0.2982 0.3148 0.016 2bz8:A
9 6vld:B 469 57 0.2742 0.0362 0.2982 0.019 6tkv:A, 6tkv:B, 6vld:A, 6vlg:A, 6vlg:B, 6vlg:C, 6vlg:D, 6x5h:A, 6x5h:B, 6x5h:C, 6x5r:B, 6x5r:A, 6x5s:A, 6x5s:B, 6x5t:A, 6x5t:B, 6x5t:C, 6x5t:D, 6x5t:E, 6x5t:F, 6x5t:G, 6x5t:H, 6x5u:E, 6x5u:B, 6x5u:D, 6x5u:F, 6x5u:A, 6x5u:G, 6x5u:C, 6x5u:H
10 3i5r:A 81 66 0.3226 0.2469 0.3030 0.027
11 2sem:B 59 52 0.2258 0.2373 0.2692 0.052 1sem:A, 1sem:B, 2sem:A, 3sem:A, 3sem:B
12 1b07:A 59 50 0.2581 0.2712 0.3200 0.052 6atv:A, 1cka:A, 1ckb:A, 5ih2:A, 5ih2:B, 5l23:A, 5ul6:A
13 7uy0:A 448 53 0.2258 0.0312 0.2642 0.053 7uy0:B, 7uy3:A
14 4e6r:A 58 51 0.2903 0.3103 0.3529 0.076
15 6ipz:Z 63 53 0.2258 0.2222 0.2642 0.093 1a0n:B, 1azg:B, 4eik:A, 1fyn:A, 8kdx:A, 3ua7:A, 3ua7:D, 3ua7:C, 4znx:A, 4znx:D, 4znx:B, 4znx:C
16 1lck:A 164 55 0.2097 0.0793 0.2364 0.32 1bhf:A, 1cwd:L, 1cwe:A, 1cwe:C, 1fbz:A, 1fbz:B, 2iim:A, 1ijr:A, 1lcj:A, 1lkk:A, 1lkl:A, 1x27:A, 1x27:B, 1x27:C, 1x27:D, 1x27:E, 1x27:F
17 6f55:A 67 55 0.2419 0.2239 0.2727 1.1
18 2o9v:A 67 55 0.2419 0.2239 0.2727 1.1 4ln2:A
19 6a9c:B 66 54 0.2097 0.1970 0.2407 1.7
20 8qlp:B 452 21 0.1290 0.0177 0.3810 2.8 8qlp:F, 8qlp:J, 8qlp:N
21 1wlp:B 138 53 0.2419 0.1087 0.2830 3.2 1ov3:A, 1ov3:B, 7yxw:A
22 4xvi:A 647 30 0.1935 0.0185 0.4000 3.7 4xvk:A, 4xvl:A, 4xvm:A
23 6g5q:B 381 34 0.1774 0.0289 0.3235 4.3 6g5o:A, 6g5o:B, 6g5q:A
24 8ifk:B 409 21 0.1290 0.0196 0.3810 4.4
25 8k34:B 434 21 0.1290 0.0184 0.3810 4.4 8ifl:B, 8ifl:G, 8ifl:K, 8ifl:O, 8ifm:B, 8ifm:G, 8ifm:K, 8ifm:O
26 2wkw:A 315 28 0.2097 0.0413 0.4643 4.6 2wkw:B
27 8isz:A 465 21 0.1290 0.0172 0.3810 4.9 8it0:A, 8it0:E, 8it1:I, 8it1:M, 8it1:A, 8it1:E, 8j8h:A, 8j9g:A, 8j9p:A, 8j9p:C, 8jay:A, 8jay:C, 8jay:I, 8jay:M, 8k9g:A, 8k9g:E, 8u72:C, 8u72:E, 8u72:I, 8u72:G
28 3tto:A 1055 47 0.2581 0.0152 0.3404 4.9 3tto:B, 3tto:C, 3tto:D, 3ttq:A, 4ttu:A, 4tvc:A, 4tvd:A
29 8u7b:C 507 21 0.1290 0.0158 0.3810 5.3
30 4wpc:B 288 37 0.2097 0.0451 0.3514 6.9 4wpc:A
31 8oz6:B 473 21 0.1290 0.0169 0.3810 8.1 8ffi:B, 8ffi:F, 8ffi:L, 8ffi:N, 8i87:F, 8i87:T, 8i87:B, 8i87:D, 8i88:B, 8j7s:A, 8j7s:E, 8j7s:I, 8j7s:M, 8jr8:A, 8jr8:C, 8oz6:D, 8oz6:F, 8oz6:H, 8ozd:B, 8ozd:D, 8oze:F, 8oze:H, 8ozf:B, 8ozf:E, 8ozf:G, 8ozf:M, 8ozg:B, 8ozg:E, 8ozg:G, 8ozg:M, 8ozi:B, 8ozi:D, 8ozi:F, 8ozi:H, 8sp0:B, 8sp0:F, 8sp3:B, 8sp3:F, 8spo:B, 8spo:F, 8spo:L, 8spo:N, 8squ:B
32 8dgq:A 272 35 0.1774 0.0404 0.3143 9.0 8dgq:B, 6pxc:A, 6way:A

[Back]
Reference:
  • Chengxin Zhang, Xi Zhang, Peter L Freddolino, and Yang Zhang. BioLiP2: an updated structure database for biologically relevent ligand-protein interactions, Nucleic Acids Research, gkad630 (2023)(download the PDF file).
  • Jianyi Yang, Ambrish Roy, and Yang Zhang. BioLiP: a semi-manually curated database for biologically relevant ligand-protein interactions, Nucleic Acids Research, 41: D1096-D1103 (2013) (download the PDF file).

    • zhanglabzhanggroup.org | +65-6601-1241 | Computing 1, 13 Computing Drive, Singapore 117417