GSEFSAMMYIQELRSGLRDMHLLSCLESLRVSLNNNPVSWVQTFGAEGLASLLDILKRLHDEKGNYDSRNQHEIIRCLKA
FMNNKFGIKTMLETEEGILLLVRAMDPAVPNMMIDAAKLLSALCILPQPEDMNERVLEAMTERAEMDEVERFQPLLDGLK
SGTSIALKVGCLQLINALITPAEELDFRVHIRSELMRLGLHQVLQELREIENEDMKVQLCVFDEQGDEDFFDLK
The query sequence (length=234) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 3obv:D | 327 | 237 | 0.9872 | 0.7064 | 0.9747 | 9.35e-167 | 2bap:B, 2bap:A, 2f31:A, 8fg1:A, 3obv:A, 3obv:B, 3obv:C, 4uwx:A, 4uwx:B |
2 | 4awd:A | 297 | 23 | 0.0427 | 0.0337 | 0.4348 | 0.38 | 4awd:B |
3 | 2k4i:A | 134 | 44 | 0.0513 | 0.0896 | 0.2727 | 1.1 | |
4 | 8gzh:Z | 1217 | 52 | 0.0897 | 0.0173 | 0.4038 | 2.6 | |
5 | 8gzg:Z | 1175 | 52 | 0.0897 | 0.0179 | 0.4038 | 2.8 | |
6 | 7xkw:A | 499 | 74 | 0.0641 | 0.0301 | 0.2027 | 3.5 | |
7 | 6zyw:Y | 1133 | 43 | 0.0641 | 0.0132 | 0.3488 | 9.0 | 6zyx:Y |
8 | 7udu:D | 701 | 63 | 0.0769 | 0.0257 | 0.2857 | 9.1 | 7rb8:D |