GRNRGRLLCMLALTFMFMVLEVVVSRVTSSLAMLSDSFHMLSDVLALVVALVAERFARRTHATQKNTFGWIRAEVMGALV
NAIFLTGLCFAILLEAIERFIEPHEMQQPLVVLGVGVAGLLVNVLGLCLFHHGHSHGGHGHGHDRAGQLNMRGVFLHVLG
DALGSVIVVVNALVFYFSWKGCSEGDFCVNPCFPDPCKAYEAGPCWVLYLDPTLCVVMVCILLYTTYPLLKESALILLQT
VPKQIDIRNLIKELRNVEGVEEVHELHVWQLAGSRIIATAHIKCEDPTSYMEVAKTIKDVFHNHGIHATTIQPEF
The query sequence (length=315) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8zsz:A | 315 | 315 | 1.0000 | 1.0000 | 1.0000 | 0.0 | 8zsb:A, 8zsb:B, 8zsz:B |
2 | 8j80:B | 288 | 316 | 0.2603 | 0.2847 | 0.2595 | 2.03e-28 | 8j7u:A, 8j7u:B, 8j7w:A, 8j7w:B, 8j7y:A, 8j7y:B |
3 | 6xpd:B | 303 | 315 | 0.2476 | 0.2574 | 0.2476 | 3.15e-26 | 6xpd:A, 6xpe:B, 6xpe:A |
4 | 7y5g:B | 302 | 312 | 0.2635 | 0.2748 | 0.2660 | 1.23e-25 | 7y5g:A, 7y5h:B, 7y5h:A |
5 | 6vd8:A | 85 | 77 | 0.0794 | 0.2941 | 0.3247 | 1.74e-04 | 6vd8:B |
6 | 2qfi:A | 286 | 102 | 0.0857 | 0.0944 | 0.2647 | 4.37e-04 | 3h90:A, 3h90:B, 3h90:C, 3h90:D, 2qfi:B |
7 | 2qfi:A | 286 | 115 | 0.0921 | 0.1014 | 0.2522 | 3.3 | 3h90:A, 3h90:B, 3h90:C, 3h90:D, 2qfi:B |
8 | 4obw:D | 235 | 59 | 0.0508 | 0.0681 | 0.2712 | 1.8 | 4obw:A, 4obw:C, 4obw:B |
9 | 1cv8:A | 173 | 62 | 0.0698 | 0.1272 | 0.3548 | 2.0 | |
10 | 4ejx:A | 1034 | 33 | 0.0381 | 0.0116 | 0.3636 | 2.1 | 4enz:A, 2j5w:A, 1kcw:A |
11 | 8iqi:C | 916 | 70 | 0.0635 | 0.0218 | 0.2857 | 2.7 | 8iqc:A, 8iqc:B, 8iqd:A, 8iqd:B, 8iqd:C, 8iqd:D, 8iqi:A, 8iqi:B, 8iqi:D, 8iqi:E, 8iqi:F |
12 | 7thn:B | 478 | 120 | 0.0921 | 0.0607 | 0.2417 | 4.3 | |
13 | 8p4x:A | 526 | 54 | 0.0444 | 0.0266 | 0.2593 | 5.4 | 8p4x:B |
14 | 3ab1:B | 336 | 68 | 0.0635 | 0.0595 | 0.2941 | 6.9 | 3ab1:A |
15 | 7wli:A | 1135 | 80 | 0.0730 | 0.0203 | 0.2875 | 8.2 | 7wlj:A, 7wlk:A, 7wll:A |
16 | 4bnr:J | 58 | 14 | 0.0254 | 0.1379 | 0.5714 | 8.2 | 1bhc:J, 4bnr:I, 1bpi:A, 1bz5:A, 2fi3:I, 2fi4:I, 2fi5:I, 3fp7:J, 2ftl:I, 2ftm:B, 3ldj:B, 3ldj:C, 6pti:A, 1qlq:A |
17 | 9f14:A | 324 | 50 | 0.0476 | 0.0463 | 0.3000 | 9.9 | 9f14:B, 9fdd:A, 9fdd:B, 9fdd:C, 9fdd:D, 9fdd:E, 9fdd:F, 9fdd:G, 9fdd:H, 4lq2:A, 4lq5:A, 4m4g:A |