GRLFKITACVPSQTRIRTQRELQNTYFTKLVPYENWFREQQRIQKMGGKIVKVELATGKQGINTGLA
The query sequence (length=67) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
| # | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
|---|---|---|---|---|---|---|---|---|
| 1 | 1b33:N | 67 | 67 | 1.0000 | 1.0000 | 1.0000 | 5.14e-45 | |
| 2 | 8tpj:C | 67 | 66 | 0.8657 | 0.8657 | 0.8788 | 9.50e-40 | |
| 3 | 7wi4:A | 410 | 31 | 0.2090 | 0.0341 | 0.4516 | 0.42 | 7wi4:D, 7wi4:E, 7wi4:F, 7wi4:B, 7wi4:C |
zhanggroup.org