GRKLELTKAEDTQLTKRVKNAAANVLRETWLIYKNTKLVKKIDHAKVRKHQRKFLQAIHQLRSVKMEQRKLNDQANTLVD
LAKTQLE
The query sequence (length=87) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 4j9z:B | 97 | 95 | 1.0000 | 0.8969 | 0.9158 | 1.36e-54 | 6ale:B, 4g27:B, 5v02:B, 5v03:B, 5wbx:B, 5wc5:B |
2 | 4obo:A | 275 | 71 | 0.2184 | 0.0691 | 0.2676 | 0.37 | 4obq:A, 4u41:A, 4u42:B |
3 | 6ra7:A | 302 | 80 | 0.2644 | 0.0762 | 0.2875 | 0.41 | 5ax9:A, 5ax9:C, 5d7a:A, 5d7a:B, 5d7a:C, 5di1:A, 5j95:A, 4obp:A, 6ra5:A, 4rvt:A, 4u40:A, 4u42:A, 4u43:A, 4u44:A, 4u45:A, 5w5q:A, 8wm0:A, 2x7f:B, 2x7f:C, 7xzq:A, 7xzr:A, 7xzr:B, 4zk5:A, 4zp5:A |
4 | 2x7f:A | 276 | 80 | 0.2644 | 0.0833 | 0.2875 | 0.42 | 5ax9:B, 2x7f:D, 2x7f:E |
5 | 8pmq:9 | 412 | 62 | 0.1954 | 0.0413 | 0.2742 | 2.8 | |
6 | 7vnr:A | 333 | 58 | 0.1379 | 0.0360 | 0.2069 | 7.1 | 7vnr:C, 7vnr:E, 7vnr:G |