GRKKIQITRIMDERNRQVTFTKRKFGLMKKAYELSVLADAEIALIIFNSSNKLFQYASTDMDKVLLKYTEYNEP
The query sequence (length=74) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8c84:B | 93 | 74 | 0.9324 | 0.7419 | 0.9324 | 1.36e-46 | 6byy:D, 6bz1:D, 1c7u:A, 1c7u:B, 8c84:A, 1egw:A, 1egw:B, 1egw:C, 1egw:D, 3kov:B, 3kov:A, 3kov:I, 3kov:J, 3mu6:A, 3mu6:B, 3mu6:D, 3mu6:C, 3p57:A, 3p57:B, 3p57:C, 3p57:D, 3p57:I, 3p57:J, 8pde:D, 8pde:E, 8pde:A, 8pde:B, 8q9n:A, 8q9n:B, 8q9p:B, 8q9p:A, 8q9q:A, 8q9q:B, 8q9r:A, 8q9r:B, 8q9r:E, 8q9r:F, 6wc2:C, 7x1n:A, 7x1n:D, 7x1n:B, 7x1n:C, 7xuz:D, 7xuz:C, 7xuz:H, 7xuz:G |
2 | 1n6j:A | 93 | 74 | 0.8784 | 0.6989 | 0.8784 | 1.16e-45 | 6byy:A, 6byy:B, 6byy:C, 6bz1:C, 6bz1:A, 6bz1:B, 1n6j:B, 1tqe:P, 1tqe:Q, 1tqe:R, 1tqe:S, 6wc2:I, 6wc2:J, 6wc2:D, 6wc2:A, 6wc2:B, 6wc5:A, 6wc5:B, 6wc5:C, 6wc5:D |
3 | 1mnm:A | 85 | 64 | 0.3108 | 0.2706 | 0.3594 | 1.17e-11 | 1mnm:B |
4 | 1hbx:E | 89 | 65 | 0.3108 | 0.2584 | 0.3538 | 8.34e-10 | 1hbx:A, 1hbx:B, 1hbx:D, 1k6o:B, 1k6o:C, 1srs:A, 1srs:B |