>protein
GRIPGRQWIGKHRRPRFVSLRAKQNMIRRLEIEAENHYWLSMPYMTREQERGHAAVRRREAFEAIKAAATSKFPPHRFIA
DQLDHLNVTKKWS
The query sequence (length=93) is searched through a non-redundant set of database sequences
protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# |
Hit |
Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value |
Homologs to hit |
1 |
7a5f:o3 |
94 |
93 |
1.0000 |
0.9894 |
1.0000 |
4.91e-66 |
7a5g:o3, 7a5h:o, 7a5i:o3, 7a5j:o, 7a5k:o3, 8any:o, 6i9r:o, 3j7y:o, 3j9m:o, 8k2a:L6, 8k2b:L6, 7l08:o, 7l20:o, 6nu2:o, 6nu3:o, 7o9k:o, 7o9m:o, 7odr:o, 7ods:o, 7odt:o, 7of0:o, 7of2:o, 7of3:o, 7of4:o, 7of5:o, 7of6:o, 7of7:o, 7og4:o, 7oi6:o, 7oi7:o, 7oi8:o, 7oi9:o, 7oia:o, 7oib:o, 7oic:o, 7oid:o, 7oie:o, 8oir:Be, 8oit:Be, 5ool:o, 5oom:o, 7pd3:o, 8pk0:o, 7po4:o, 7qh6:o, 7qh7:o, 7qi4:o, 7qi5:o, 7qi6:o, 8qsj:o, 8qu5:o, 6vlz:o, 6vmi:o, 8xt0:L6, 8xt1:L6, 8xt2:L6, 8xt3:L6, 6zm5:o, 6zm6:o, 6zs9:o, 6zsa:o, 6zsb:o, 6zsc:o, 6zsd:o, 6zse:o, 6zsg:o |
2 |
5aj4:Bt |
94 |
93 |
0.7204 |
0.7128 |
0.7204 |
2.09e-38 |
6gaw:Bt, 6gb2:Bt, 7nqh:Bt, 7nql:Bt, 7nsh:Bt, 7nsi:Bt, 7nsj:Bt, 8oin:Be, 8oiq:Be, 6ydp:Bt, 6ydw:Bt |
3 |
4mdh:A |
333 |
30 |
0.1183 |
0.0330 |
0.3667 |
1.4 |
4mdh:B, 5mdh:A, 5mdh:B, 7rm9:A |
4 |
4nuf:A |
549 |
37 |
0.1613 |
0.0273 |
0.4054 |
5.2 |
|
5 |
5wti:Z |
982 |
18 |
0.1075 |
0.0102 |
0.5556 |
6.3 |
|
[Back]