BioLiP

>protein
GQVVADVLCEFLEVAVHLILYVREVYPVGIFQKRKKYNVPVQMSCHPELNQYIQDTLHCVKPLLEKNDVEKVVVVILDKE
HRPVEKFVFEITQIDSLLSHVEQLLAAFILKISVCDAVLDHNPPGCTFTVLVHTREAATRNMEKIQVIKDFPWILADEQD
VHMHDPRLIPLKTMTSDILKMQLYVEERAHK

The query sequence (length=191) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	6ekj:A	206	196	0.9529	0.8835	0.9286	1.17e-129	3abd:B, 3abe:C, 6bc8:A, 6bcd:A, 6bi7:A, 6bi7:C, 6ekl:A, 6ekm:A, 4ext:C, 4gk0:A, 4gk0:B, 4gk5:A, 4gk5:B, 6k07:A, 6k08:A, 5o8k:A, 6ve5:A, 3vu7:C, 6ws0:CCC, 6ws5:CCC, 6ww9:A, 6ww9:B, 5xpt:A
2	3abd:A	180	192	0.9215	0.9778	0.9167	8.98e-123	6bi7:E, 5xpu:A
3	6bi7:G	154	186	0.7906	0.9805	0.8118	5.90e-92
4	2v64:A	210	88	0.1518	0.1381	0.3295	1.60e-08	6f0x:Z, 1klq:A, 2qyf:A, 2qyf:C, 2v64:F, 2v64:C
5	6sc2:B	3930	51	0.1047	0.0051	0.3922	0.49	6rla:A, 6rla:B, 6sc2:A
6	8t3p:A	477	50	0.0995	0.0398	0.3800	1.0	8t3p:B
7	7cpx:A	2262	150	0.1780	0.0150	0.2267	1.6	7cpx:B, 7cpy:A, 7cpy:B
8	3lwa:A	167	25	0.0576	0.0659	0.4400	2.9
9	8p2k:MA	315	95	0.1257	0.0762	0.2526	3.4	2b3h:A, 2b3k:A, 9f1d:EA, 4fli:A, 4flj:A, 4flk:A, 4fll:A, 2g6p:A, 2gz5:A, 4hxx:A, 4ikr:A, 4iks:A, 4ikt:A, 4iku:A, 4iu6:A, 6lzb:A, 6lzc:A, 2nq6:A, 2nq7:A, 4u1b:A, 4u69:A, 4u6c:A, 4u6e:A, 4u6j:A, 4u6w:A, 4u6z:A, 4u70:A, 4u71:A, 4u73:A, 4u75:A, 4u76:A, 5ykp:A, 5yr4:A, 5yr5:A, 5yr6:A, 5yr7:A
10	2mkk:A	213	54	0.0995	0.0892	0.3519	3.5
11	4rh7:A	3005	43	0.0890	0.0057	0.3953	3.7
12	6hd7:t	838	157	0.1885	0.0430	0.2293	4.0
13	4hnx:A	713	157	0.1885	0.0505	0.2293	4.0
14	4xnh:A	786	157	0.1885	0.0458	0.2293	4.2	4hnw:A, 6o07:A, 4xpd:A, 4y49:G
15	4oxi:A	526	35	0.0838	0.0304	0.4571	5.8
16	1vhl:A	208	66	0.1099	0.1010	0.3182	9.7	6ari:A, 6ari:B, 1vht:A, 1vht:B, 1vht:C

[Back]