GPPSGKTYMGWWGHMGGPKQKGITSYAVSPYAQKPLQGIFHNAVFNSFRRFKSQFLYVLIPAGIYWYWWKNGNEYNEFLY
SKAGREELERVNV
The query sequence (length=93) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8e7s:H | 93 | 93 | 1.0000 | 1.0000 | 1.0000 | 8.51e-66 | 8e7s:h |
2 | 7o3e:R | 72 | 62 | 0.1935 | 0.2500 | 0.2903 | 0.020 | |
3 | 8boz:A | 541 | 63 | 0.2043 | 0.0351 | 0.3016 | 0.93 | 8boz:C, 8boz:M, 8boz:O |
4 | 8boz:G | 558 | 63 | 0.2043 | 0.0341 | 0.3016 | 0.94 | 8boz:E, 8boz:I, 8boz:K |
5 | 8e9h:F | 436 | 36 | 0.1290 | 0.0275 | 0.3333 | 2.8 | 8e9g:F, 8e9i:F |
6 | 4uau:A | 226 | 28 | 0.1075 | 0.0442 | 0.3571 | 3.5 | 4uas:A, 4uas:B, 4uat:A, 4uat:B, 4uau:B |
7 | 8upk:A | 739 | 43 | 0.1720 | 0.0217 | 0.3721 | 5.5 | 8uph:A, 8uph:B, 8upk:B, 8upm:A, 8upm:B |
8 | 1op0:A | 234 | 44 | 0.1828 | 0.0726 | 0.3864 | 8.8 |