BioLiP

>protein
GPLGSGQQRAGDWKCPNPTCENMNFSWRNECNQCKAPKPDG

The query sequence (length=41) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	6g99:B	41	41	1.0000	1.0000	1.0000	1.78e-25
2	1n0z:A	45	31	0.3415	0.3111	0.4516	6.94e-05
3	2k1p:A	33	29	0.3659	0.4545	0.5172	0.001
4	8f5o:B	1134	22	0.2195	0.0079	0.4091	0.090	8f5p:B
5	7v3u:6	646	11	0.1951	0.0124	0.7273	0.34	7qhs:6, 7v3u:F, 7v3v:6, 7v3v:F, 7w8g:6, 7w8g:F, 7z13:6, 7z13:e
6	5u8t:6	661	11	0.1951	0.0121	0.7273	0.34	6wgi:6
7	5v8f:6	692	11	0.1951	0.0116	0.7273	0.34	8b9a:6, 8b9b:6, 8b9c:6, 6eyc:6, 3ja8:6, 8kg6:6, 8kg8:6, 8kg9:6, 7p30:6, 7p30:E, 7p5z:6, 7p5z:E, 8p5e:6, 8p62:6, 8p63:6, 7pmk:6, 7pmn:6, 6ptn:m, 6ptn:6, 6pto:l, 6pto:6, 7pt6:6, 7pt6:F, 7pt7:6, 7pt7:F, 6rqc:6, 6skl:6, 6sko:6, 6u0m:6, 5u8s:6, 8w7m:6, 8xgc:6
8	4u65:E	181	14	0.2195	0.0497	0.6429	0.37	4u65:F
9	7dg2:A	231	14	0.2195	0.0390	0.6429	1.2
10	8b1t:B	1141	28	0.2439	0.0088	0.3571	3.6	8b1u:B, 7mr3:B, 6sjb:B, 6sje:B, 6sjf:B, 6sjg:B, 6t2u:B, 6t2v:B
11	8b1r:B	1170	28	0.2439	0.0085	0.3571	3.6	3k70:B, 3k70:E, 5ld2:B, 7mr4:B, 1w36:B, 1w36:E
12	7arc:D	395	26	0.2195	0.0228	0.3462	3.9	7ard:D
13	3uel:A	521	14	0.1707	0.0134	0.5000	4.5	5a7r:A, 4b1h:A, 4b1i:A, 4b1j:A, 6hh6:A, 6hmk:A, 6hml:A, 6hmm:A, 6hmn:A, 7kfp:A, 7kg0:A, 7kg1:A, 7kg6:A, 7kg7:A, 7kg8:A, 5lhb:A, 4n9y:A, 4n9z:A, 4n9z:B, 4na0:A, 4na0:B, 4na0:C, 4na4:A, 4na4:B, 4na4:C, 6o9x:A, 6o9y:A, 6oa0:A, 6oa1:A, 6oa3:A, 6oak:A, 6oal:A, 3uel:B, 3uel:C
14	3it3:A	337	25	0.2439	0.0297	0.4000	6.0	4e3w:A, 4e3w:B, 3it0:A, 3it0:B, 3it3:B
15	2jyd:A	46	43	0.2927	0.2609	0.2791	9.1

[Back]