GPISLVLRLRNSKKELNDIRFEFTPGRDTAEGVSQELISAGLVDGRDLVIVAANLQKIVEEPQSNRSVTFKLASGVEGSD
IPDDGKLIGFAQLSIS
The query sequence (length=96) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2v3s:B | 96 | 96 | 1.0000 | 1.0000 | 1.0000 | 2.64e-64 | 2v3s:A |
2 | 6fbk:A | 83 | 49 | 0.1667 | 0.1928 | 0.3265 | 0.34 | |
3 | 5n2j:B | 1381 | 83 | 0.2083 | 0.0145 | 0.2410 | 0.72 | 6fsn:A, 5mu1:A, 5mzo:A, 5n2j:A, 3wzs:A, 7zhb:A, 7zkc:A, 7zle:A, 7zll:A, 7zlu:A, 7zlu:B, 7zlu:C, 7zxw:A |
4 | 6asv:C | 311 | 46 | 0.1875 | 0.0579 | 0.3913 | 3.8 | 6asv:A, 6asv:B, 4s2u:A, 7xmu:A, 7xmu:F, 7xmu:C, 7xmu:D, 7xmu:B, 7xmu:E, 7xmv:A, 7xmv:F, 7xmv:C, 7xmv:E, 7xmv:B, 7xmv:D, 7xn3:A, 7xn3:E, 7xn3:C, 7xn3:B, 7xn3:D, 7xn3:F |
5 | 5eb8:A | 354 | 36 | 0.1354 | 0.0367 | 0.3611 | 6.2 | 5eb8:B, 5eba:A, 5efd:A, 5efd:B, 5eff:A, 5eff:B, 2f8q:A, 2f8q:B, 2fgl:A, 2fgl:B, 4qce:A, 4qce:B, 4qcf:A, 4qdm:A, 4qdm:B, 5xc0:A, 5xc0:B, 5xc1:A, 5xc1:B |
6 | 7msc:Y | 68 | 22 | 0.1146 | 0.1618 | 0.5000 | 8.2 | 7f0d:Y, 7kgb:Y, 7msh:Y, 7msm:Y, 7msz:Y, 7mt2:Y, 7mt3:Y, 7mt7:Y, 7sfr:Y, 5v7q:Y, 5v93:Y |