GPHMDYDMLTEEQKKKLKEDHTLKILLKNNYVREVFKQFTLSNDKIGYLSHYINDPTIVQVIDHIMKTIDDT
The query sequence (length=72) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7qdw:A | 72 | 72 | 1.0000 | 1.0000 | 1.0000 | 3.13e-48 | |
2 | 4xrm:B | 64 | 29 | 0.1806 | 0.2031 | 0.4483 | 0.057 | 5bng:B, 5bng:A, 5eg0:A, 5ego:A, 8vts:B, 8vts:D, 8vtt:D, 4xrm:A, 4xrs:A, 4xrs:B |
3 | 8k4l:A | 216 | 25 | 0.1389 | 0.0463 | 0.4000 | 1.6 | 8k3d:A, 8k4l:B |
4 | 7arc:I | 199 | 29 | 0.1528 | 0.0553 | 0.3793 | 1.7 | 7ard:I |
5 | 4v7e:BK | 96 | 31 | 0.1806 | 0.1354 | 0.4194 | 1.7 | 8ip8:da, 8ip9:da, 8ipa:da, 8ipb:da, 8jiw:BK, 8r57:K |
6 | 7k5n:A | 237 | 36 | 0.1667 | 0.0506 | 0.3333 | 2.0 | |
7 | 8yb6:I | 268 | 29 | 0.1806 | 0.0485 | 0.4483 | 4.8 | 8yha:I |
8 | 8yb6:G | 377 | 29 | 0.1806 | 0.0345 | 0.4483 | 5.2 | 8yb6:D, 8yb6:E, 8yb6:F, 8yb6:H, 8yha:E, 8yha:F, 8yha:G, 8yha:H |
9 | 4auc:A | 323 | 29 | 0.1250 | 0.0279 | 0.3103 | 5.3 | 1czi:E |
10 | 8yha:D | 355 | 29 | 0.1806 | 0.0366 | 0.4483 | 5.6 | |
11 | 5c2y:A | 178 | 18 | 0.1250 | 0.0506 | 0.5000 | 8.2 | 5c2y:B |
12 | 8bdc:A | 963 | 39 | 0.2083 | 0.0156 | 0.3846 | 9.3 | 8bdc:B, 8bdc:C, 8bdc:D |