GPFYLMRELPGSTELTGSTNLITHYNLEQAYNKFCGKKVKEKLSNFLPDLPGMIDLPGSHDNSSLRSLIEKPPILSSSFN
PITGTMLAGFRLH
The query sequence (length=93) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8gxq:s | 93 | 93 | 1.0000 | 1.0000 | 1.0000 | 7.41e-65 | |
2 | 6k8d:A | 290 | 82 | 0.2151 | 0.0690 | 0.2439 | 0.11 | 6ikz:B, 6k8d:B, 6k8d:C, 6k8d:D, 6knj:A, 6knj:B, 6knl:A, 6knl:B |
3 | 5mcp:F | 342 | 39 | 0.1613 | 0.0439 | 0.3846 | 0.60 | |
4 | 6kgy:B | 441 | 76 | 0.1828 | 0.0385 | 0.2237 | 0.90 | 6kgy:A, 6kgy:C, 6kgy:D, 6kod:A, 6kod:B, 6kod:C, 6kod:D, 6kyy:A, 6kyy:B, 6kyy:C, 6kyy:D |
5 | 4cv5:A | 185 | 39 | 0.1290 | 0.0649 | 0.3077 | 9.0 | |
6 | 6q45:A | 476 | 32 | 0.1183 | 0.0231 | 0.3438 | 9.4 | 6q45:B, 6q45:C, 6q45:I, 6q45:J, 6q45:K |