GPDLQPVTYSEPAFWCSIAYYELNQRVGETFHASQPSLTVDGFTDPSNSERFCLGLLSNVNRNATVEMTRRHIGRGVRLY
YIGGEVFAECLSDSAIFVQSPNCNQRPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGFEAVYQLTRMCTIRMSFVKGWG
AEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQM
The query sequence (length=193) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6m64:A | 203 | 192 | 0.9741 | 0.9261 | 0.9792 | 3.88e-140 | 7co1:A, 7co1:C, 7co1:E, 6m64:C, 6m64:E, 5xod:A, 6zvq:A |
2 | 1dd1:B | 249 | 219 | 0.4767 | 0.3695 | 0.4201 | 1.36e-51 | 1dd1:A, 1dd1:C |
3 | 4wa0:A | 358 | 52 | 0.0674 | 0.0363 | 0.2500 | 1.0 | |
4 | 5xnl:B | 503 | 55 | 0.0933 | 0.0358 | 0.3273 | 1.0 | 8c29:B, 8c29:b, 3jcu:B, 3jcu:b, 5mdx:b, 5mdx:B, 7oui:B, 7oui:b, 5xnl:b, 5xnm:B, 5xnm:b, 6yp7:b, 6yp7:B |
5 | 5gom:A | 407 | 57 | 0.0933 | 0.0442 | 0.3158 | 3.7 | 5gnr:A, 5gof:A, 5gom:B, 5yew:A, 5yew:B, 5yew:C |
6 | 5goe:A | 384 | 57 | 0.0933 | 0.0469 | 0.3158 | 4.0 | 5gns:A, 5gnt:A |
7 | 8wg3:A | 548 | 76 | 0.1192 | 0.0420 | 0.3026 | 4.3 | |
8 | 8u8w:A | 297 | 91 | 0.1192 | 0.0774 | 0.2527 | 4.7 | |
9 | 2e3x:B | 129 | 16 | 0.0466 | 0.0698 | 0.5625 | 7.4 | |
10 | 6dc6:C | 996 | 50 | 0.0725 | 0.0141 | 0.2800 | 10.0 | 6dc6:A, 1z7l:A, 1z7l:B, 1z7l:C |