BioLiP

>protein
GMRQGAGLGYRRDLAEGFLQLRNNDRIQFMEIAPENWIKMGGFARYQFDKVAEKIPILIHGLSLSLGGQAPLDKELLSSI
KAMIKQYNTPFFSDHLSFLLPMPFTDEAVKHTAARIREVQDFLEIQISVENTSYYLHSETSTMNEVEFLNAIVQEANCGI
HLDVNNIYVNAVNHGLLDPHVFIDNVDLKRVNYIHIAGTVWDLLEYTYARLSHMPPTLLERFPPFEKLCKEVDIIHQLQQ
KYVKKRGLSWLKI

The query sequence (length=253) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	3bww:A	253	253	1.0000	1.0000	1.0000	0.0
2	8hi7:B	295	168	0.1818	0.1559	0.2738	3.55e-15	8hi8:B
3	7dz9:B	260	57	0.0711	0.0692	0.3158	0.43	7dz9:A
4	8evu:E	198	65	0.0791	0.1010	0.3077	1.00	8a1t:E, 8a1u:E, 8a1v:E, 8a1w:E, 8a1x:E, 8a1y:E, 8acw:E, 8acy:E, 8ad0:E, 8ew3:E, 7xk3:E, 7xk4:E, 7xk5:E, 7xk6:E, 7xk7:E
5	3oc4:A	422	114	0.1146	0.0687	0.2544	1.5	3oc4:B
6	5yli:B	309	94	0.1067	0.0874	0.2872	3.1	5yli:A, 5ylk:B, 5ylk:A, 5yll:B, 5yll:A, 5z4t:B, 5z4t:A
7	6w5r:A	1194	121	0.1225	0.0260	0.2562	4.2	3gki:A, 3gkj:A, 6w5s:A, 6w5t:A, 6w5u:A, 6w5v:A
8	6uox:A	1161	121	0.1225	0.0267	0.2562	4.6
9	3jd8:A	1133	121	0.1225	0.0274	0.2562	4.8
10	6fnu:A	296	24	0.0514	0.0439	0.5417	7.1
11	2qa5:B	234	51	0.0553	0.0598	0.2745	9.1	2qa5:A, 2qag:A, 2qnr:A
12	8i0w:J	571	25	0.0514	0.0228	0.5200	9.9	7dvq:J, 8i0u:J, 8i0v:J, 6icz:J, 6id0:J, 6id1:J, 6qdv:S, 7w59:J, 7w5a:J, 7w5b:J, 5xjc:J, 5yzg:J, 5z56:J, 5z57:J, 5z58:J

[Back]