GMQYEWRKAELIGQLLNLGVTPGGVLLVHSSFRSVRPLEDGPLGLIEALRAALGPGGTLVMPSWSGLDDEPFDPATSPVT
PDLGVVSDTFWRLPNVKRSAHPFAFAAAGPQAEQIISDPLPHSPASPVARVHELDGQVLLLGVGHDANTTLALAELMAKV
PYGVPRHCTIGKLVRVDYLENDHCCERFALADRWLKEKSLQKEGPVGHAFARLIRSRDIVATALGQLGRDPLIPPEAGCE
EC
The query sequence (length=242) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6mn5:D | 260 | 250 | 0.9959 | 0.9269 | 0.9640 | 3.23e-171 | 6mn3:A, 6mn3:B, 6mn4:A, 6mn4:B, 6mn4:C, 6mn4:D, 6mn4:E, 6mn4:F, 6mn5:A, 6mn5:B, 6mn5:C, 6mn5:E, 6mn5:F |
2 | 3kzl:A | 266 | 240 | 0.3017 | 0.2744 | 0.3042 | 2.14e-27 | 3ijw:A, 3ijw:B, 3kzl:D, 3kzl:C, 3kzl:B, 3n0m:A, 3n0m:B, 3n0s:A, 3n0s:D, 3n0s:C, 3n0s:B, 3slb:A, 3slb:D, 3slb:C, 3slb:B, 3slf:A, 3slf:B |
3 | 6bc2:A | 268 | 264 | 0.3719 | 0.3358 | 0.3409 | 5.07e-26 | 6bbz:A, 6bc3:A, 6bc4:A, 6bc5:A, 6bc7:A, 6np2:A, 6np3:A, 6np4:A, 6np5:A, 6nti:A, 6ntj:A, 6o5u:A |
4 | 3sma:B | 268 | 248 | 0.3512 | 0.3172 | 0.3427 | 8.22e-24 | 3sma:A, 3sma:C, 3sma:D |
5 | 2nyg:A | 270 | 247 | 0.2975 | 0.2667 | 0.2915 | 2.85e-17 | 2nyg:B, 2nyg:C, 2nyg:D, 2nyg:E |
6 | 5ht0:C | 261 | 251 | 0.3140 | 0.2912 | 0.3028 | 7.93e-15 | 5ht0:A, 5ht0:B, 5ht0:D, 5ht0:E, 5ht0:F, 7kes:A, 7kes:B, 6mn0:A, 6mn0:B, 6mn0:C, 6mn0:F, 6mn0:D, 6mn0:E, 6mn1:A, 6mn1:B, 6mn2:A, 6mn2:B |
7 | 7q1d:D | 272 | 250 | 0.3182 | 0.2831 | 0.3080 | 9.65e-15 | 7mqk:A, 7mqk:B, 7mqk:C, 7mqk:D, 7mql:A, 7mql:B, 7mql:C, 7mql:D, 7mqm:A, 7mqm:B, 7mqm:C, 7mqm:D, 7q0q:A, 7q0q:B, 7q10:A, 7q1d:A, 7q1d:B, 7q1d:C, 7q1x:A |
8 | 6mb6:A | 268 | 161 | 0.2355 | 0.2127 | 0.3540 | 1.88e-12 | 6mb4:B, 6mb5:A, 6mb6:C, 6mb7:A, 6mb9:A, 6mb9:B, 6mb9:D, 6mb9:C |
9 | 8bd3:6 | 217 | 40 | 0.0702 | 0.0783 | 0.4250 | 5.6 | 8bd3:0 |