GMPTPTFLVCPDVVKFENVGQIAVVNGMVYLGGSVGIDKSGTLHKGLEEQTRQTFDNIRKCLEYANSGLDYIVSLNIFLS
TSLSDSEEARFNELYREVFCVPATRPCRCCVRAQLQEGLLVEVVNVVAAQK
The query sequence (length=131) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 3i3f:A | 131 | 131 | 1.0000 | 1.0000 | 1.0000 | 3.21e-95 | 3i3f:B, 3i3f:C |
2 | 7cd4:A | 124 | 103 | 0.2672 | 0.2823 | 0.3398 | 3.49e-11 | 7cd4:C |
3 | 8yrc:A | 125 | 102 | 0.2519 | 0.2640 | 0.3235 | 9.21e-10 | |
4 | 3k0t:C | 124 | 97 | 0.2595 | 0.2742 | 0.3505 | 1.91e-07 | 3k0t:A, 3k0t:B |
5 | 5v4d:A | 127 | 101 | 0.2519 | 0.2598 | 0.3267 | 3.18e-07 | 5v4d:B, 5v4d:E |
6 | 2uyk:C | 127 | 102 | 0.2061 | 0.2126 | 0.2647 | 2.96e-05 | 2uyn:A, 2uyn:B, 2uyn:C |
7 | 3vcz:B | 127 | 100 | 0.2061 | 0.2126 | 0.2700 | 0.005 | |
8 | 7ov8:A | 303 | 53 | 0.1374 | 0.0594 | 0.3396 | 0.024 | 7ov2:A, 7ov3:A, 5uq6:A, 1ute:A |
9 | 1qhw:A | 300 | 53 | 0.1374 | 0.0600 | 0.3396 | 0.33 | 1qfc:A |
10 | 1war:A | 310 | 53 | 0.1298 | 0.0548 | 0.3208 | 2.6 | 2bq8:X |
11 | 1clv:A | 471 | 57 | 0.1527 | 0.0425 | 0.3509 | 3.5 | 1jae:A, 1tmq:A, 1viw:A |
12 | 4lox:A | 300 | 39 | 0.1145 | 0.0500 | 0.3846 | 6.3 | 5e5o:A, 5e5s:A, 5e63:A, 5e67:A, 4z1z:A, 4z1z:B, 4z20:A, 4z20:D |
13 | 7oik:A | 4426 | 69 | 0.1527 | 0.0045 | 0.2899 | 7.2 | 7oim:A, 6tax:A, 6tay:A |