GMIDIHSHIVFDVDDGPKSREESKALLAESYRQGVRTIVSTSHRRKGMFETPEEKIAENFLQVREIAKEVASDLVIAYGA
EIYYTPDVLDKLEKKRIPTLNDSRYALIEFSMNTPYRDIHSALSKILMLGITPVIAHIERYDALENNEKRVRELIDMGCY
TQVNSSHVLKPKLFGERYKFMKKRAQYFLEQDLVHVIASDMHNLDGRPPHMAEAYDLVTQKYGEAKAQELFIDNPRKIVM
DQLI
The query sequence (length=244) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2wjd:A | 244 | 244 | 1.0000 | 1.0000 | 1.0000 | 0.0 | 3qy8:A, 2wje:A, 2wjf:A |
2 | 3qy6:A | 247 | 245 | 0.2992 | 0.2955 | 0.2980 | 2.02e-28 | 3qy7:A |
3 | 4cvh:A | 391 | 36 | 0.0656 | 0.0409 | 0.4444 | 0.51 | |
4 | 6wvk:D | 1184 | 97 | 0.1148 | 0.0236 | 0.2887 | 1.1 | 6wvj:D |
5 | 7f75:D | 1142 | 97 | 0.1148 | 0.0245 | 0.2887 | 1.2 | 7ckq:D |
6 | 8x6f:D | 1176 | 97 | 0.1148 | 0.0238 | 0.2887 | 1.2 | 8x6g:D |
7 | 4v2x:A | 534 | 198 | 0.1762 | 0.0805 | 0.2172 | 2.7 | |
8 | 2yxo:B | 265 | 202 | 0.1721 | 0.1585 | 0.2079 | 3.4 | 2yxo:A, 2yz5:A, 2yz5:B, 2z4g:A, 2z4g:B |
9 | 6swl:A | 133 | 44 | 0.0533 | 0.0977 | 0.2955 | 6.5 | 6swl:B |
10 | 6rup:A | 111 | 80 | 0.0820 | 0.1802 | 0.2500 | 7.7 | 6rup:B, 8uzt:A, 8uzt:C, 8uzt:D |
11 | 7tmb:A | 362 | 98 | 0.1025 | 0.0691 | 0.2551 | 9.8 | 7tmb:B, 7tmb:C, 7tmb:D, 7tmb:E, 7tmb:F |
12 | 1np6:B | 169 | 76 | 0.1107 | 0.1598 | 0.3553 | 10.0 |