BioLiP

>protein
GMDAVNAFNQELFSLMDMKPPISRAKMILITKAAIKAIKLYKHVVQIVEKFIKKCKPEYKVPGLYVIDSIVRQSRHQFGT
DKDVFGPRFSKNITATFQYLYLCPSEDKSKIVRVLNLWQKNGVFKIEIIQPLLDMAAG

The query sequence (length=138) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	6xkb:C	139	138	1.0000	0.9928	1.0000	4.50e-101	6xkb:B, 6xkb:A, 6xkb:E, 6xkb:D
2	3d9k:B	141	137	0.8043	0.7872	0.8102	1.65e-79	3d9k:A, 3d9l:A, 3d9l:B, 3d9m:A, 3d9m:B, 3d9n:A, 3d9n:B, 3d9o:B, 3d9p:A, 3d9p:B
3	2mow:A	161	141	0.2464	0.2112	0.2411	3.10e-06	6gc3:A, 2lo6:A, 6o3w:A, 6o3w:B, 6o3x:A, 6o3x:B, 6o3x:C, 6o3y:A, 6o3y:B, 6o3y:C
4	4jxt:A	130	94	0.1667	0.1769	0.2447	2.34e-05
5	1sza:B	140	97	0.1884	0.1857	0.2680	2.59e-05	2bf0:X
6	4q94:A	129	94	0.1667	0.1783	0.2447	7.83e-04	9b9l:A, 4q94:B, 4q96:A, 4q96:B, 4q96:D, 4q96:E
7	1dli:A	402	108	0.1739	0.0597	0.2222	1.4	1dlj:A
8	8a7d:Q	273	63	0.1449	0.0733	0.3175	1.7
9	2h4z:A	255	69	0.1449	0.0784	0.2899	2.4	2f90:A, 2f90:B, 2h4z:B, 2hhj:A, 2hhj:B, 7n3r:B, 7n3s:A, 7n3s:B, 7thi:A, 7thi:B
10	5f7v:A	388	40	0.0797	0.0284	0.2750	3.9
11	6njy:A	237	68	0.1232	0.0717	0.2500	5.3	6njy:B
12	6ks6:g	520	47	0.1232	0.0327	0.3617	6.4	6ks6:G, 4v81:C, 4v81:k, 4v8r:AG, 4v8r:Ag, 4v8r:BG, 4v8r:Bg, 4v94:C, 4v94:K, 4v94:c, 4v94:k, 7ylw:G, 7ylw:g, 7ylx:G, 7ylx:g, 7yly:G, 7yly:g
13	5mmj:w	82	34	0.0870	0.1463	0.3529	7.4	5mmm:w
14	1gpm:A	501	92	0.1449	0.0399	0.2174	7.8	1gpm:B, 1gpm:C, 1gpm:D
15	4js4:A	468	78	0.1522	0.0449	0.2692	8.6	3c94:A, 4hcb:A, 4hcb:B, 4hcc:A, 4hcc:B, 3hl8:A, 3hp9:A, 4jrp:A, 4jrp:B, 4jrq:A, 4jrq:B, 4js4:B, 4js5:A, 4js5:B
16	2qxf:A	433	78	0.1522	0.0485	0.2692	8.7

[Back]