GLRIRRPMNAFMVWAKDERKRLAQQNPDLHNAVLSKMLGKAWKELNTAEKRPFVEEAERLRVQHLRDHPNYKYRPR
The query sequence (length=76) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 4y60:C | 76 | 76 | 1.0000 | 1.0000 | 1.0000 | 2.55e-52 | |
2 | 6l6y:D | 80 | 74 | 0.8684 | 0.8250 | 0.8919 | 2.33e-45 | 4a3n:A, 3f27:D, 6l6y:F |
3 | 4s2q:D | 76 | 73 | 0.6842 | 0.6842 | 0.7123 | 3.33e-34 | 4euw:A |
4 | 6t78:A | 77 | 73 | 0.6053 | 0.5974 | 0.6301 | 9.97e-32 | 6t78:B, 3u2b:C |
5 | 1gt0:D | 79 | 74 | 0.5658 | 0.5443 | 0.5811 | 1.34e-31 | 8bx1:E, 8bx2:E, 6ht5:D, 1o4x:B, 6t90:L, 6yov:L |
6 | 2gzk:A | 159 | 72 | 0.4868 | 0.2327 | 0.5139 | 1.89e-23 | 9bvd:C, 9bvd:F, 9bvd:I, 6cil:N, 6edb:B, 1hry:A, 1hrz:A, 1j46:A, 1j47:A, 6oem:N, 6oem:H, 6oen:N, 6oen:H, 6oeo:N, 6oer:H |
7 | 2gzk:A | 159 | 68 | 0.2237 | 0.1069 | 0.2500 | 0.007 | 9bvd:C, 9bvd:F, 9bvd:I, 6cil:N, 6edb:B, 1hry:A, 1hrz:A, 1j46:A, 1j47:A, 6oem:N, 6oem:H, 6oen:N, 6oen:H, 6oeo:N, 6oer:H |
8 | 7m5w:A | 138 | 70 | 0.3553 | 0.1957 | 0.3857 | 1.26e-12 | 6jrp:A, 6jrp:D, 6jrp:G, 6jrp:J |
9 | 2lef:A | 86 | 73 | 0.2632 | 0.2326 | 0.2740 | 1.36e-07 | |
10 | 5jh0:D | 157 | 60 | 0.2237 | 0.1083 | 0.2833 | 1.75e-06 | 5jgh:A, 5jgh:D, 5jgh:G, 5jgh:J, 5jh0:A |
11 | 5jh0:D | 157 | 55 | 0.1842 | 0.0892 | 0.2545 | 0.001 | 5jgh:A, 5jgh:D, 5jgh:G, 5jgh:J, 5jh0:A |
12 | 1j5n:A | 93 | 54 | 0.2368 | 0.1935 | 0.3333 | 3.27e-06 | |
13 | 6cik:N | 90 | 49 | 0.1974 | 0.1667 | 0.3061 | 0.001 | 6cg0:N, 6cim:N |
14 | 6cij:N | 133 | 49 | 0.2105 | 0.1203 | 0.3265 | 0.002 | 5zdz:N, 5ze1:N, 5ze2:N |
15 | 1e7j:A | 74 | 41 | 0.1447 | 0.1486 | 0.2683 | 0.010 | 3nm9:D, 3nm9:G, 3nm9:J, 3nm9:P, 3nm9:M, 3nm9:A, 1qrv:A, 1qrv:B, 8r1x:A |
16 | 6hb4:A | 197 | 49 | 0.1447 | 0.0558 | 0.2245 | 0.15 | 6erp:C, 6erp:G, 6erq:C, 6erq:G, 6hb4:D, 6hb4:G, 6hb4:J, 6hc3:A, 6hc3:D, 6hc3:G, 6hc3:J, 7lbw:A, 7lbw:B, 7lbx:A, 7lbx:B, 4nnu:A, 4nnu:B, 4nod:A, 4nod:B, 4nod:G, 4nod:H, 3tmm:A, 3tq6:A, 3tq6:B |
17 | 1e6z:B | 498 | 39 | 0.1842 | 0.0281 | 0.3590 | 0.33 | 7c34:A, 7c34:B, 7c92:A, 7c92:B, 7cb1:A, 7cb1:B, 1e6r:A, 1e6r:B, 1e6z:A, 1h0g:B, 1h0g:A, 1h0i:A, 1h0i:B, 6jk9:A, 6jk9:B, 6jkf:A, 6jkf:B, 1o6i:A, 1o6i:B, 1ogg:A, 1ogg:B, 1ur8:A, 1ur8:B, 1ur9:A, 1ur9:B, 1w1p:A, 1w1p:B, 1w1t:A, 1w1t:B, 1w1v:A, 1w1v:B, 1w1y:A, 1w1y:B, 3wd1:A, 3wd2:A, 3wd3:A, 3wd4:A, 4z2g:A, 4z2h:A, 4z2i:A, 4z2j:A, 4z2k:A, 4z2l:A |
18 | 6zm7:CE | 124 | 38 | 0.1711 | 0.1048 | 0.3421 | 1.7 | 8k2c:CE, 8xsy:CE, 6z6l:CE, 6zme:CE |
19 | 7bzc:A | 535 | 30 | 0.1711 | 0.0243 | 0.4333 | 2.6 | 7bzb:A |
20 | 3en1:A | 424 | 54 | 0.1842 | 0.0330 | 0.2593 | 2.7 | 3eqq:A |
21 | 5vsu:A | 387 | 59 | 0.2632 | 0.0517 | 0.3390 | 5.8 | 6aso:A, 2kh9:A, 4n0t:A, 5tf6:A, 5tf6:C |
22 | 8h2w:B | 984 | 47 | 0.1974 | 0.0152 | 0.3191 | 6.4 | 8h2w:A, 5nz8:B |