GLFSQKSFLVLGFSNENESNIANIIKENAGKIMVADYAVVPLLGCEVEATVGEVVTNTWLVTCIDYQTLFDPKSNPLFTP
VPVMTGMTPLEDCVISFSQCAGAEKESLTFLANLLGASVQEYFVRKSNAKKGMFASTHLILKERGGSKYEAAKKWNLPAV
TIAWLLETARTGKRADESHFLIENST
The query sequence (length=186) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6rmm:D | 190 | 190 | 0.9892 | 0.9684 | 0.9684 | 1.05e-134 | 6rmm:C, 3ueo:B, 3ueo:D, 3ueo:A, 3ueo:C |
2 | 5u6k:E | 191 | 190 | 0.8118 | 0.7906 | 0.7947 | 9.53e-111 | 5u6k:A, 5u6k:B, 5u6k:C, 5u6k:D |
3 | 6rml:B | 278 | 74 | 0.1505 | 0.1007 | 0.3784 | 7.10e-08 | |
4 | 6rml:B | 278 | 147 | 0.1828 | 0.1223 | 0.2313 | 0.16 | |
5 | 6j0x:B | 466 | 110 | 0.1559 | 0.0622 | 0.2636 | 0.016 | 6j0w:A, 6j0w:B, 6j0x:A, 6j0x:C, 6j0x:D |
6 | 6hm3:A | 183 | 47 | 0.0806 | 0.0820 | 0.3191 | 0.022 | 4bu0:A, 4bu1:A, 4bu1:B, 6hm4:A |
7 | 2am1:A | 454 | 68 | 0.1237 | 0.0507 | 0.3382 | 0.12 | 2am2:A, 3zm5:A, 3zm6:A |
8 | 8fh4:B | 297 | 39 | 0.0591 | 0.0370 | 0.2821 | 4.6 | 8cdw:A, 8cdw:B, 8cij:A, 6cqd:A, 6cqd:B, 6cqf:A, 8fh4:A, 8fh4:C, 8fh4:D, 8fjz:A, 8fjz:B, 8fjz:C, 8fjz:D, 8fjz:E, 8fjz:F, 8fko:A, 8fko:B, 8fko:C, 8fko:D, 8fko:E, 7kac:A, 7kac:B, 7l24:A, 7l24:B, 7l24:C, 7l24:D, 7l25:A, 7l25:B, 7l26:A, 7l26:B, 7l26:C, 7l26:D, 7m0k:A, 7m0k:B, 7m0k:C, 7m0k:D, 7m0l:A, 7m0l:B, 7m0l:C, 7m0l:D, 7m0m:A, 7m0m:B, 6nfy:A, 6nfy:B, 6nfz:A, 6nfz:B, 6ng0:A, 6ng0:B, 8par:A, 8pas:A, 8pas:B, 8pau:A, 8pau:B, 7r9l:A, 7r9n:A, 7r9n:B, 7r9p:A, 7r9p:B, 7r9t:A, 7r9t:B, 7siu:A, 7siu:B, 8xn7:A, 8xn7:B |
9 | 8p0o:A | 622 | 87 | 0.1022 | 0.0305 | 0.2184 | 5.3 | 8p0o:B, 8p0p:A, 8p0p:B, 8p0q:A, 8p0q:B |
10 | 4r9x:A | 225 | 38 | 0.0753 | 0.0622 | 0.3684 | 6.4 | 4r9x:B |
11 | 9eq5:A | 511 | 72 | 0.0968 | 0.0352 | 0.2500 | 7.7 | 9eq5:D, 9eq5:B, 9eq5:C |
12 | 8ido:C | 128 | 75 | 0.1075 | 0.1562 | 0.2667 | 9.1 | 8ido:D |