BioLiP

>protein
GLEEFFDDPKNWGQEKVKSGAAWTCQQLRNKSNEDLHKLWYVLLKERNMLLTLEQEAKRQRLPMPSPERLDKVVDSMDAL
DKVVQEREDALRLLQTGQERARPGAWRRDIFGRIIWHKFKQWVIPWHLNKRYNRKRFFALPYVDHFLRLEREKRARIKAR
KENLERKKAKILLKK

The query sequence (length=175) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	8any:Y	181	175	1.0000	0.9669	1.0000	8.44e-127	7a5f:Y3, 7a5g:Y3, 7a5h:Y, 7a5i:Y3, 7a5j:Y, 7a5k:Y3, 4ce4:2, 6i9r:Y, 3j7y:Y, 3j9m:Y, 8k2a:Lu, 8k2b:Lu, 7l08:Y, 7l20:Y, 6nu2:Y, 6nu3:Y, 7o9k:Y, 7o9m:Y, 7odr:Y, 7ods:Y, 7odt:Y, 7of0:Y, 7of2:Y, 7of3:Y, 7of4:Y, 7of5:Y, 7of6:Y, 7of7:Y, 7og4:XY, 7oi6:Y, 7oi7:Y, 7oi8:Y, 7oi9:Y, 7oia:Y, 7oib:Y, 7oic:Y, 7oid:Y, 7oie:Y, 8oir:BF, 8oit:BF, 5ool:Y, 5oom:Y, 7pd3:Y, 8pk0:Y, 7po4:Y, 7qh6:Y, 7qh7:Y, 7qi4:Y, 7qi5:Y, 7qi6:Y, 8qsj:Y, 8qu1:Y, 8qu5:Y, 6vlz:Y, 6vmi:Y, 8xt0:Lu, 8xt1:Lu, 8xt2:Lu, 8xt3:Lu, 6zm5:Y, 6zm6:Y, 6zs9:XY, 6zsa:XY, 6zsb:XY, 6zsc:XY, 6zsd:XY, 6zse:XY, 6zsg:XY
2	6gaw:B2	179	175	0.8800	0.8603	0.8800	1.91e-112	5aj4:B2, 6gb2:B2, 7nqh:B2, 7nql:B2, 7nsh:B2, 7nsi:B2, 7nsj:B2, 8oin:BF, 8oiq:BF, 4v19:2, 6ydp:B2, 6ydw:B2
3	6xyw:Ay	111	87	0.2343	0.3694	0.4713	4.88e-16
4	6yxx:A2	463	93	0.2114	0.0799	0.3978	9.12e-13	7aoi:A2, 6hiv:A2, 6hix:A2, 6yxy:A2
5	7aih:R	472	115	0.2400	0.0890	0.3652	3.76e-11	7am2:R, 7ane:R
6	6z1p:AC	284	133	0.2686	0.1655	0.3534	3.96e-11
7	6ywe:T	180	109	0.2286	0.2222	0.3670	1.97e-09	6yws:T, 6ywv:T, 6ywx:T, 6ywy:T
8	7pkt:w	120	90	0.1943	0.2833	0.3778	1.10e-07
9	5mrc:T	216	28	0.0857	0.0694	0.5357	0.003	3j6b:T, 5mre:T, 5mrf:T
10	3gvh:A	318	127	0.1714	0.0943	0.2362	0.91	3gvh:B, 3gvh:C, 3gvh:D, 3gvi:A, 3gvi:B, 3gvi:C, 3gvi:D, 3gvi:E, 3gvi:F
11	6oz1:A	643	36	0.0800	0.0218	0.3889	1.4
12	5oa1:U	291	106	0.1486	0.0893	0.2453	1.9
13	7qjt:A	267	122	0.1714	0.1124	0.2459	5.8
14	6m9g:A	280	102	0.1771	0.1107	0.3039	8.1	6eg7:A, 6eg7:B, 6m9g:B
15	6g9f:A	539	36	0.0800	0.0260	0.3889	8.7	6g9s:A
16	5jzi:D	207	46	0.0743	0.0628	0.2826	9.0	8gom:D, 8gon:D, 5jhd:D, 5jhd:I, 5jzi:I, 5yxn:A, 5yxu:A

[Back]