GLAQFIKVNVTLENGEPVFIYTDANGQVCQGDITVTQAGTITYLLNDQTLKGLKFVGVGFVTPFDGIIDAVTISSDGMLV
QLVDLDKTPGTTKFQFVLSNTANTLLVLSAD
The query sequence (length=111) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 3njh:D | 122 | 111 | 0.9820 | 0.8934 | 0.9820 | 3.77e-73 | 3n55:A, 3njf:A, 3njf:C, 3njg:A, 3njh:A, 3njh:B, 3njh:C, 3nji:A, 3njj:A, 3njl:A, 3njn:A, 3njn:C |
2 | 5hy7:B | 1170 | 56 | 0.1622 | 0.0154 | 0.3214 | 0.24 | |
3 | 6v7g:A | 357 | 73 | 0.2072 | 0.0644 | 0.3151 | 0.62 | 1dgr:X, 1dgr:V, 1dgr:N, 1dgw:X, 6v7j:A, 6v7j:B, 6v7j:C, 6v7l:A, 6v7l:B, 6v7l:C |
4 | 8tj5:M | 1659 | 24 | 0.1171 | 0.0078 | 0.5417 | 1.1 | 8tj5:O |
5 | 6qpw:A | 183 | 75 | 0.1441 | 0.0874 | 0.2133 | 2.1 | |
6 | 8i34:A | 175 | 44 | 0.0991 | 0.0629 | 0.2500 | 3.1 | 8i34:C, 8i34:E, 8i34:G |
7 | 3vmw:A | 324 | 52 | 0.1441 | 0.0494 | 0.3077 | 5.6 | |
8 | 1jl3:A | 137 | 62 | 0.1622 | 0.1314 | 0.2903 | 7.7 | 1jl3:B, 1jl3:C, 1jl3:D |
9 | 9f8x:A | 572 | 45 | 0.1171 | 0.0227 | 0.2889 | 8.6 | 9f8x:B, 9f8x:C, 9f8x:D, 1qni:A, 1qni:B, 1qni:C, 1qni:D, 1qni:E, 1qni:F |