GKVKKRLPQAKRACAKCQKDNKKCDDARPCQRCIKAKTDCIDLPRKKRPTGVRRGPYK
The query sequence (length=58) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6o19:A | 59 | 58 | 1.0000 | 0.9831 | 1.0000 | 8.98e-35 | 6e33:A |
2 | 6gys:B | 579 | 31 | 0.1897 | 0.0190 | 0.3548 | 0.091 | 6f07:B, 6gyp:B, 6gys:C, 6gys:J, 6gys:I, 6gyu:B, 7k7g:M, 8ow1:CE |
3 | 1ajy:A | 71 | 36 | 0.2586 | 0.2113 | 0.4167 | 0.21 | 1ajy:B, 1zme:C, 1zme:D |
4 | 1pyi:A | 88 | 35 | 0.2241 | 0.1477 | 0.3714 | 2.2 | 1pyi:B |
5 | 8y6b:D | 517 | 22 | 0.1552 | 0.0174 | 0.4091 | 4.6 | 8hpy:D, 8hpy:E, 8hq0:D, 8hq0:E, 8hq0:F, 8hq1:D, 8hq1:E, 8hq1:F, 8hq2:D, 8hq2:E, 5y2z:J, 5y2z:B, 5y2z:D, 5y2z:F, 5y2z:H, 5y2z:L, 5y31:B, 5y31:D, 8y6b:F, 8y6b:E |
6 | 3wpd:A | 752 | 17 | 0.1207 | 0.0093 | 0.4118 | 4.7 | 3wpc:A, 3wpc:B, 5y3j:A, 5y3j:B, 5y3k:A, 5y3k:B, 5y3l:A, 5y3l:B |
7 | 2je2:A | 157 | 40 | 0.2586 | 0.0955 | 0.3750 | 5.0 | 8gar:A, 2je3:A |
8 | 4e54:B | 402 | 18 | 0.1379 | 0.0199 | 0.4444 | 6.5 | 4e5z:B, 6r8y:L, 6r8z:L, 6r90:L, 6r91:L, 6r92:L |