GKSASGIIMETQQAKQTLADIEARHADIMKLETSIRELHDMFMDMAMLVESQGEMIDRIEYNVEAAVDYIETAKVDTKKA
VK
The query sequence (length=82) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 1l4a:B | 82 | 82 | 1.0000 | 1.0000 | 1.0000 | 4.77e-55 | |
2 | 3hd7:B | 98 | 68 | 0.6707 | 0.5612 | 0.8088 | 4.57e-35 | 3rk2:B, 5w5c:B |
3 | 1fio:A | 190 | 37 | 0.2195 | 0.0947 | 0.4865 | 7.34e-05 | |
4 | 8qeo:A | 2146 | 54 | 0.1829 | 0.0070 | 0.2778 | 0.18 | |
5 | 8qen:A | 2363 | 54 | 0.1829 | 0.0063 | 0.2778 | 0.18 | 9bja:A, 9bja:B, 2bvl:A, 2bvm:A, 6c0b:A, 7lou:A, 7lou:B, 7lov:A, 7lov:B, 3pa8:A, 3pa8:B, 3pee:B, 3pee:A, 7s0y:A, 5uqm:A, 5uqn:A, 5uqt:A, 5uqt:B |
6 | 8y9b:B | 1607 | 54 | 0.1829 | 0.0093 | 0.2778 | 0.24 | |
7 | 8ew9:A | 241 | 54 | 0.1829 | 0.0622 | 0.2778 | 2.9 | |
8 | 6ywo:A | 354 | 37 | 0.1463 | 0.0339 | 0.3243 | 3.1 | 6ywn:A, 6ywo:B, 6ywo:C, 6ywo:D |
9 | 9fmd:M | 224 | 48 | 0.1829 | 0.0670 | 0.3125 | 3.3 | 8c6j:y, 8i0u:M, 8i0v:M, 8i0w:M, 6icz:M, 6id0:M, 6id1:M, 5mqf:N, 6qdv:y, 8ro2:M, 7w59:M, 7w5a:M, 7w5b:M, 5xjc:M, 5yzg:M |
10 | 3hrd:B | 330 | 35 | 0.1463 | 0.0364 | 0.3429 | 5.0 | 3hrd:F |
11 | 1kc7:A | 872 | 43 | 0.1463 | 0.0138 | 0.2791 | 5.1 | |
12 | 4gsk:B | 572 | 49 | 0.1829 | 0.0262 | 0.3061 | 6.5 | 4gsk:A |
13 | 4gsl:A | 598 | 49 | 0.1829 | 0.0251 | 0.3061 | 6.5 | 4gsl:B, 3rui:A, 3t7e:A, 3t7g:B, 3t7g:A, 3vh1:A, 3vh2:A, 3vh3:A, 3vh4:A, 5yec:A, 5yec:C |
14 | 8dqw:A | 522 | 43 | 0.1707 | 0.0268 | 0.3256 | 7.7 | 8fs3:A, 8fs5:A, 8fs6:A, 8fs7:A, 8fs8:A, 7sgz:A, 7st9:A, 7stb:A |