Home Research COVID-19 Services Publications People Teaching Job Opening News Forum Lab Only
Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

BioLiP
>protein
GKQGRRFDAQQYLVTSAQALERHYSRNGLYPASQSLANSPYYSFSYTPTADKFGFSLKAVPTNRQSDPCGTLSLDHKGVR
VPATNCWSH

The query sequence (length=89) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

# Hit Hit
length 		Aligned
length 		Identity
(normalized by query) 		Identity
(normalized by hit) 		Identity (normalized
by aligned length) 		E-value Homologs
to hit
1 4d40:B 89 89 1.0000 1.0000 1.0000 8.34e-64 4us7:B
2 6bja:A 382 34 0.1124 0.0262 0.2941 1.8
3 1w7j:A 752 51 0.1798 0.0213 0.3137 2.9 7pm5:A, 7pm6:A, 7pm6:D, 7pm7:A, 7pm8:A, 7pm9:A, 7pma:A, 7pmb:A, 7pmc:A, 7pmd:A, 7pme:A, 7pme:D, 7pmf:A, 7pmg:A, 7pmh:A, 7pmi:A, 7pmj:A, 7pml:A, 1w7i:A
4 2x7j:A 579 25 0.1236 0.0190 0.4400 3.1 2x7j:B, 2x7j:C, 2x7j:D
5 7n4y:B 2455 69 0.2360 0.0086 0.3043 7.7 7n4y:A
6 8pjd:A 347 22 0.1124 0.0288 0.4545 7.9 8bva:A, 8c1j:A, 5ful:A, 5fwa:A, 5fwd:A, 5jmq:A
7 5fx8:A 563 48 0.1685 0.0266 0.3125 9.0 5fx8:B

[Back]
Reference:
  • Chengxin Zhang, Xi Zhang, Peter L Freddolino, and Yang Zhang. BioLiP2: an updated structure database for biologically relevent ligand-protein interactions, Nucleic Acids Research, gkad630 (2023)(download the PDF file).
  • Jianyi Yang, Ambrish Roy, and Yang Zhang. BioLiP: a semi-manually curated database for biologically relevant ligand-protein interactions, Nucleic Acids Research, 41: D1096-D1103 (2013) (download the PDF file).

    • zhanglabzhanggroup.org | +65-6601-1241 | Computing 1, 13 Computing Drive, Singapore 117417