GHMVSCCYRSLAAPDLTLRDLLDIVETSQAHNARAQLTGALFYSQGVFFQWLEGRPAAVAEVMTHIQRDRRHSNVEILAE
EPIAKRRFAGWHMQLSCSEADMRSLGLAESRQIVTV
The query sequence (length=116) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2bun:A | 121 | 110 | 0.9138 | 0.8760 | 0.9636 | 1.19e-76 | |
2 | 4hh0:A | 383 | 114 | 0.9483 | 0.2872 | 0.9649 | 2.04e-75 | 4hh0:B, 4hh1:A, 4hh1:B, 2iyg:A, 2iyg:B, 2iyi:A, 2iyi:B, 1yrx:A, 1yrx:B, 1yrx:C |
3 | 2hfo:A | 150 | 87 | 0.3103 | 0.2400 | 0.4138 | 1.16e-15 | 2hfn:A, 2hfn:B, 2hfn:C, 2hfn:D, 2hfn:E, 2hfn:F, 2hfn:G, 2hfn:H, 2hfn:I, 2hfn:J, 2hfo:B, 2hfo:C, 2hfo:D, 2hfo:E, 2hfo:F, 2hfo:G, 2hfo:H, 2hfo:I, 2hfo:J, 3mzi:A, 3mzi:B, 3mzi:C, 3mzi:D, 3mzi:E, 3mzi:F |
4 | 8i98:F | 143 | 93 | 0.3017 | 0.2448 | 0.3763 | 1.09e-14 | 8i98:A, 8i98:B, 8i98:C, 8i98:D, 8i98:E, 8i98:G, 8i98:H, 8i98:I, 8i98:J, 8i98:K, 8i98:L, 8i98:M, 8i98:N, 8i98:O, 8i98:P, 8i98:Q, 8i98:R, 8i98:S, 8i98:T, 1x0p:A, 1x0p:B, 1x0p:C, 1x0p:D, 1x0p:E, 1x0p:F, 1x0p:G, 1x0p:H, 1x0p:I, 1x0p:J |
5 | 2byc:A | 137 | 108 | 0.3276 | 0.2774 | 0.3519 | 2.00e-12 | 2byc:B |
6 | 6w6z:A | 151 | 107 | 0.2931 | 0.2252 | 0.3178 | 2.71e-12 | 6w72:A, 6w72:B |
7 | 5m2a:A | 346 | 93 | 0.2931 | 0.0983 | 0.3656 | 1.22e-11 | 5m27:A, 5m27:B, 5m2a:B, 5mbb:A, 5mbb:B, 5mbc:A, 5mbc:B, 5mbd:A, 5mbd:B, 5mbe:A, 5mbe:B, 5mbh:A, 5mbj:A, 5mbk:A, 5nby:A |
8 | 3gfx:B | 394 | 93 | 0.2759 | 0.0812 | 0.3441 | 3.27e-09 | 3gfx:A, 3gfz:A, 3gfz:B, 3gg0:A, 3gg0:B, 3gg1:A, 3gg1:B, 2kb2:A |
9 | 3gfy:B | 374 | 93 | 0.2759 | 0.0856 | 0.3441 | 3.56e-09 | 3gfy:A |
10 | 4yut:A | 351 | 94 | 0.2586 | 0.0855 | 0.3191 | 1.51e-08 | 8qfe:A, 8qff:A, 8qfg:A, 8qfh:A, 8qfi:A, 8qfj:A, 5x4t:A, 5x4u:A, 5x4v:A, 4yus:A, 4yut:B |
11 | 5dx9:A | 307 | 60 | 0.1724 | 0.0651 | 0.3333 | 4.2 | |
12 | 5vqa:A | 368 | 28 | 0.1034 | 0.0326 | 0.4286 | 8.0 | 5wc2:A |
13 | 6f0x:B | 398 | 28 | 0.1034 | 0.0302 | 0.4286 | 8.6 | 6f0x:A, 6f0x:C, 6f0x:D, 6f0x:E, 7l9p:A, 7l9p:B, 7l9p:C, 7l9p:D, 7l9p:E |
14 | 3q2k:C | 347 | 40 | 0.1034 | 0.0346 | 0.3000 | 9.8 | 3q2k:A, 3q2k:B, 3q2k:D, 3q2k:F, 3q2k:G, 3q2k:H, 3q2k:I, 3q2k:J, 3q2k:M, 3q2k:N, 3q2k:O |