GHMSNNFELKLQMSKVKGVSLHKFHLVNDLRGNLSVGEFEKDIPFTPKRYFTVFGVPNKEVRGEHAHKECKQFLICVSGN
CSVLVDDGENREEYVLDSIDKGIYLPPMTWGVQYKYSKDAVLLVFASHYYDSDDYIRDYSTFKQMR
The query sequence (length=146) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 4mzu:F | 294 | 140 | 0.9589 | 0.4762 | 1.0000 | 6.99e-103 | 4mzu:A, 4mzu:C, 4mzu:E, 4mzu:B, 4mzu:D, 4mzu:G, 4mzu:I, 4mzu:K, 4mzu:H, 4mzu:J, 4mzu:L, 4zu4:A, 4zu4:B, 4zu4:C |
2 | 2pae:A | 136 | 121 | 0.3562 | 0.3824 | 0.4298 | 1.52e-31 | 2pa7:A, 2pa7:B, 2pae:B, 2pak:A, 2pak:B, 2pam:A, 2pam:B |
3 | 5tpv:B | 138 | 127 | 0.2877 | 0.3043 | 0.3307 | 1.17e-26 | 5tpv:A, 5tpv:C |
4 | 5tpu:A | 133 | 127 | 0.3219 | 0.3534 | 0.3701 | 1.59e-25 | 5tpu:B, 5tpu:C, 5tpu:D |
5 | 7n67:B | 133 | 122 | 0.3151 | 0.3459 | 0.3770 | 1.67e-24 | 7n67:A |
6 | 4o9g:A | 138 | 125 | 0.2945 | 0.3116 | 0.3440 | 2.81e-20 | 4o9e:A, 4o9e:B, 4o9g:B, 4zu5:B, 4zu7:A, 4zu7:B, 4zu7:C, 4zu7:D, 4zu7:E, 4zu7:F, 4zu7:G, 4zu7:H |
7 | 2d38:A | 156 | 66 | 0.1370 | 0.1282 | 0.3030 | 0.96 | 2d36:A, 2d37:A |
8 | 7wh0:A | 529 | 92 | 0.1918 | 0.0529 | 0.3043 | 1.8 | 7wh0:B |
9 | 4gdj:B | 321 | 21 | 0.0822 | 0.0374 | 0.5714 | 3.0 | 4gdj:C, 4gdj:D |
10 | 7ly7:A | 908 | 18 | 0.0616 | 0.0099 | 0.5000 | 3.2 | |
11 | 2iq7:E | 339 | 46 | 0.0822 | 0.0354 | 0.2609 | 4.4 | |
12 | 7aat:A | 401 | 40 | 0.0890 | 0.0324 | 0.3250 | 4.9 | 7aat:B, 8aat:A, 8aat:B, 9aat:A, 9aat:B, 1aka:A, 1aka:B, 1akb:A, 1akc:A, 1ama:A, 1ivr:A, 1map:A, 1maq:A, 1oxo:A, 1oxo:B, 1oxp:A, 1tar:A, 1tar:B, 1tas:A, 1tas:B, 1tat:A, 1tat:B |
13 | 4fvk:A | 367 | 29 | 0.0822 | 0.0327 | 0.4138 | 7.1 | 4fvk:B, 4gdi:A, 4gdi:B, 4gdi:C, 4gdi:D, 4gdi:E, 4gdi:F, 4gdj:A, 4gez:A, 4gez:B, 4gez:C, 4gez:D, 4gez:E, 4gez:F, 4gez:G, 4gez:H, 4gez:I, 4gez:J, 4gez:K, 4gez:L |