BioLiP

>protein
GFPIPDPYCWDISFRTFYTIIDDEHKTLFNGILLLSQADNADHLNELRRCTGKHFLNEQQLMQASQYAGYAEHKKAHDDF
IHKLDTWDGDVTYAKNWLVNHIKTIDFKYRGKI

The query sequence (length=113) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	1hmd:A	113	113	0.9912	0.9912	0.9912	4.08e-83	1hmd:B, 1hmd:C, 1hmd:D, 1hmo:A, 1hmo:B, 1hmo:C, 1hmo:D, 2hmq:A, 2hmq:B, 2hmq:C, 2hmq:D, 2hmz:A, 2hmz:B, 2hmz:C, 2hmz:D
2	1i4y:A	113	113	0.7876	0.7876	0.7876	7.25e-63	1i4y:B, 1i4y:C, 1i4y:D, 1i4y:E, 1i4y:F, 1i4y:G, 1i4y:H, 1i4z:A, 1i4z:B, 1i4z:C, 1i4z:D, 1i4z:E, 1i4z:F, 1i4z:G, 1i4z:H
3	1a7d:A	118	118	0.4602	0.4407	0.4407	1.00e-31	1a7e:A, 2mhr:A
4	4xpw:A	131	116	0.2920	0.2519	0.2845	2.14e-06	4xpx:A, 4xpy:A, 4xq1:A
5	3waq:A	134	110	0.2389	0.2015	0.2455	0.12	3agt:A, 3agt:B, 3agu:A, 3agu:B, 2avk:A, 2awc:A, 2awy:A, 2awy:B, 3whn:A, 3whn:B
6	2lv7:A	100	94	0.2124	0.2400	0.2553	0.68
7	9cj0:A	170	32	0.0885	0.0588	0.3125	2.7
8	4e2x:A	405	30	0.1150	0.0321	0.4333	4.7	4e2w:A, 4e2y:A, 4e2z:A, 4e30:A, 4e31:A, 4e32:A, 4e33:A, 3ndi:A, 3ndj:A
9	2rld:C	116	56	0.1327	0.1293	0.2679	5.9	2rld:A
10	7el9:A	1731	46	0.1327	0.0087	0.3261	6.6	7el9:D, 7elc:A
11	7elb:A	1937	46	0.1327	0.0077	0.3261	6.6	7ckm:A, 7elb:C, 6kld:A, 6kle:A, 6klh:A, 6klh:C
12	5t64:A	406	26	0.1062	0.0296	0.4615	7.7	5t64:B, 5t67:A, 5t67:B, 5t6b:A, 5t6b:B, 5t6b:C, 5t6b:D
13	5h9d:A	318	22	0.0885	0.0314	0.4545	9.2	5h9d:B

[Back]