GFDLNDFLEQLRQDDKVLVRMEAIINSMTMKERAKPEIIKGSRKRRIAAGSGMQVQDVNRLLKQFDDMQRMMKKMK
The query sequence (length=76) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 5gaf:i | 398 | 79 | 0.9868 | 0.1884 | 0.9494 | 6.33e-45 | 1dul:A, 1hq1:A, 3lqx:A, 2pxb:A, 2pxd:A, 2pxe:A, 2pxf:A, 2pxk:A, 2pxl:A, 2pxp:A, 2pxq:A, 2pxt:A, 2pxu:A, 2pxv:A |
2 | 2j28:9 | 430 | 104 | 0.9868 | 0.1744 | 0.7212 | 1.17e-40 | 5aka:5 |
3 | 5gad:i | 450 | 98 | 0.9079 | 0.1533 | 0.7041 | 1.44e-36 | 4c7o:A, 4c7o:C, 5gag:i, 5gah:i, 5nco:i, 7o9g:A, 7o9i:A, 2xkv:C, 2xxa:A, 2xxa:C |
4 | 7o5b:g | 403 | 103 | 0.6184 | 0.1166 | 0.4563 | 1.38e-19 | 7o9f:A, 7o9f:C, 7o9f:B, 4ue4:C |
5 | 3ndb:B | 420 | 80 | 0.3947 | 0.0714 | 0.3750 | 1.23e-10 | 2v3c:C, 2v3c:D, 4xco:D |
6 | 7epk:A | 426 | 56 | 0.3816 | 0.0681 | 0.5179 | 3.65e-10 | |
7 | 3dm5:A | 416 | 58 | 0.3421 | 0.0625 | 0.4483 | 5.75e-09 | 3dm5:B |
8 | 4xco:C | 157 | 57 | 0.3158 | 0.1529 | 0.4211 | 1.04e-08 | |
9 | 1qzw:A | 432 | 68 | 0.3947 | 0.0694 | 0.4412 | 1.20e-07 | 3kl4:A, 5l3s:A, 5l3s:C, 5l3s:E, 5l3s:G, 5l3v:A, 5l3v:B, 1qzw:C, 1qzw:E, 1qzw:G, 3zn8:M |
10 | 6z1p:AT | 166 | 59 | 0.2105 | 0.0964 | 0.2712 | 6.36e-04 | |
11 | 3jaj:z | 426 | 33 | 0.1974 | 0.0352 | 0.4545 | 0.005 | 6frk:x, 3jan:z, 7obq:x, 6r6g:AB |
12 | 7obr:x | 488 | 34 | 0.1974 | 0.0307 | 0.4412 | 0.007 | 2go5:W, 2j37:W, 5l3q:A, 5l3q:C, 1mfq:C, 7nfx:x, 7qwq:x, 1ry1:W, 4ue5:D, 6y2z:A, 6y32:A, 6y32:C, 6y32:E, 6y32:G |
13 | 7uea:U | 364 | 32 | 0.1447 | 0.0302 | 0.3438 | 1.8 | 3bsd:A, 3eni:A, 3eni:C, 8gwa:1, 8gwa:2, 8gwa:3, 8gwa:4, 8gwa:5, 8gwa:6, 5h8z:A, 5h8z:C, 6m32:E, 6m32:F, 6m32:G, 7uea:V, 7uea:W, 7ueb:U, 7ueb:V, 7ueb:W, 7ueb:X, 7ueb:Y, 7ueb:Z, 7z6q:E, 7z6q:F, 7z6q:G, 7z6q:H, 7z6q:I, 7z6q:J |
14 | 8hwy:A | 287 | 66 | 0.2632 | 0.0697 | 0.3030 | 1.8 | 8hwy:B, 8jku:A, 8jku:B |
15 | 3qo8:A | 441 | 47 | 0.1711 | 0.0295 | 0.2766 | 2.7 | 3qo7:A |
16 | 7xyz:B | 456 | 15 | 0.1447 | 0.0241 | 0.7333 | 4.1 | 7xv2:A, 7xyy:A, 7xyy:B, 7xyz:A, 7xyz:C, 7xyz:D, 7xz0:A, 7xz0:B, 7xz1:A, 7xz1:B, 7xz2:A, 7xz2:B, 7xz2:C, 7xz2:D |
17 | 7xt2:B | 388 | 15 | 0.1447 | 0.0284 | 0.7333 | 4.3 | 7xt2:A |
18 | 8jyt:C | 286 | 66 | 0.2500 | 0.0664 | 0.2879 | 8.2 | 8jyt:A, 8jyt:B, 8jyt:D |
19 | 8bk1:A | 288 | 63 | 0.2500 | 0.0660 | 0.3016 | 9.6 | 8bj5:A, 8bj5:B, 8bj5:C, 8bj5:D, 8bk1:B, 8bk1:C, 8bk1:D |