GEFSTREGEIVAGVIQRDSRANARGLVVVRIGTETKASEGVIPAAEQVPGESYEHGNRLRCYVVGVTRGAREPLITLSRT
HPNLVRKLFSLEVPEIADGSVEIVAVAREAGHRSKIAVRSNVAGLNAKGACIGPMGQRVRNVMSELSGEKIDIIDYDDDP
ARFVANALSPAKVVSVSVIDQTARAARVVVPDFQLSLAIGKEGQNARLAARLTGWRIDIRGDAPP
The query sequence (length=225) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2asb:A | 226 | 222 | 0.9867 | 0.9823 | 1.0000 | 2.56e-159 | 2atw:A, 2atw:C |
2 | 6tqn:A | 495 | 218 | 0.3778 | 0.1717 | 0.3899 | 1.44e-45 | 6gov:A, 5lm7:A, 5lm7:C, 5lm9:A, 5ms0:M, 6tqo:A, 1u9l:A, 1u9l:B, 7ubn:N, 6xas:G |
3 | 7urp:A | 159 | 73 | 0.0889 | 0.1258 | 0.2740 | 0.098 | |
4 | 1urj:B | 1030 | 110 | 0.1511 | 0.0330 | 0.3091 | 0.67 | 1urj:A |
5 | 8btj:A | 403 | 71 | 0.1022 | 0.0571 | 0.3239 | 2.4 | 8btj:B |
6 | 1j4w:A | 145 | 105 | 0.1022 | 0.1586 | 0.2190 | 2.8 | 6y2c:A |
7 | 3wqb:A | 597 | 55 | 0.0578 | 0.0218 | 0.2364 | 4.8 | 3hjr:A |
8 | 4g56:A | 617 | 92 | 0.0889 | 0.0324 | 0.2174 | 8.4 | 4g56:C |
9 | 2q1f:A | 991 | 61 | 0.0889 | 0.0202 | 0.3279 | 9.1 | 2q1f:B |