BioLiP

>protein
GEDTWMLPDVNERIEQFSQEHSSGVENEDQQEVILVRTDQSGRVWPVNTKRQMVSTHEERERVRYFHDDDNLSLNDLVKN
EKMGTAENQNKLFMRMASKFMGKTDGDYYTLDDMFVSKAAERERLGEEEENQRKKAIAEHRSLAAQMEKCLYCFDSSQFP
KHLIVAIGVKVYLCLPNVRSLTEGHCLIVPLQHHRAATLLDEDIWEEIQMFRKSLVKMFEDKGLDCIFLETNMSMKKQYH
MVYECIPLPKEVGDMAPIYFKKAIMESDEEWSMNKKLIDLSSKDIRKSVPRGLPYFSVDFGLHGGFAHVIEDQHKFPHYF
GKEIIGGMLDIEPRLWRKGIRESFEDQRKKALQFAQWWKPYDFTKSKNY

The query sequence (length=369) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	8ro2:L2	369	369	1.0000	1.0000	1.0000	0.0	6id0:U, 6id1:U
2	8ro1:L2	362	333	0.3442	0.3508	0.3814	2.35e-77
3	3jb9:c	300	201	0.1843	0.2267	0.3383	3.82e-35
4	3l7x:A	157	117	0.0678	0.1592	0.2137	0.063
5	3qdq:A	447	97	0.0650	0.0537	0.2474	1.7
6	5fw5:A	139	53	0.0434	0.1151	0.3019	3.9	4fcm:A, 4fcm:B, 7suo:A, 7suo:B, 6ta7:D, 6ta7:E, 6ta7:F, 8th1:A, 8th1:B, 8th1:C, 8th1:D, 8th5:A, 8th5:C, 8th5:F, 8th5:B, 8th5:E, 8th5:D, 8th6:D, 8th6:C, 8th6:B, 8th6:A, 8th7:A, 8th7:B, 8v1l:A, 8v1l:B, 8v1l:C, 8v1l:D, 8v1l:E, 8v1l:F, 7xhf:A, 7xhf:B, 7xhg:B, 7xhg:C, 7xhg:D
7	3mbf:A	337	149	0.0894	0.0979	0.2215	4.0	3mbd:A, 3qrh:A
8	3osg:A	110	27	0.0298	0.1000	0.4074	6.5	3osf:A, 3osf:D, 3osg:D
9	6iwq:A	546	106	0.0759	0.0513	0.2642	8.7	6iwq:B, 6iwq:C, 6iwq:D, 6iwq:E, 6iwq:F, 6iwr:A, 6iwr:B, 6iwr:C, 6iwr:D, 6iwr:E, 6iwr:F
10	2qpx:A	376	71	0.0461	0.0452	0.2394	9.3

[Back]