GDTSPAQLIAGYEAAAGAPADAERGRALFLSTQTGGKPDTPSCTTCHGADVTRAGQTRTGKEIAPLAPSATPDRFTDSAR
VEKWLGRNCNSVIGRDCTPGEKADLLAWLAAQ
The query sequence (length=112) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 1dw0:A | 112 | 112 | 1.0000 | 1.0000 | 1.0000 | 1.43e-78 | 1dw0:B, 1dw0:C, 1dw1:A, 1dw1:B, 1dw1:C, 1dw2:A, 1dw2:B, 1dw2:C, 1dw3:A, 1dw3:B, 1dw3:C |
2 | 1e8e:A | 124 | 72 | 0.2679 | 0.2419 | 0.4167 | 9.16e-17 | 1gu2:A, 1gu2:B, 1oae:A, 1oae:B |
3 | 1h1o:A | 172 | 98 | 0.2232 | 0.1453 | 0.2551 | 0.041 | 1h1o:B |
4 | 5mab:A | 259 | 38 | 0.1607 | 0.0695 | 0.4737 | 0.049 | 5mab:B, 5mab:C, 5mvo:A, 5mvo:B, 5mvo:C |
5 | 7z36:B | 446 | 28 | 0.0893 | 0.0224 | 0.3571 | 3.1 | 6h3a:A, 6h3a:F, 6qaj:A, 6qaj:B, 6qu1:A, 2yvr:A, 2yvr:B, 7z36:A |
6 | 6xyr:A | 348 | 28 | 0.0893 | 0.0287 | 0.3571 | 3.3 | |
7 | 5j04:A | 424 | 74 | 0.1964 | 0.0519 | 0.2973 | 4.7 | 5j04:B, 4rop:A |
8 | 8aya:B | 298 | 84 | 0.1786 | 0.0671 | 0.2381 | 6.4 | 4ds8:B, 5jo2:B, 3kb3:B, 4lg5:B, 4lgb:B, 5mn0:B, 7mwn:B, 3nmt:B, 5or2:B, 5or6:B, 3qn1:B, 5vs5:B, 4wvo:B, 3zvu:B |
9 | 3rt0:A | 328 | 63 | 0.1607 | 0.0549 | 0.2857 | 6.6 | 7avw:B, 8ay3:B, 8ay6:B, 8ay7:B, 8ay8:B, 8ay9:B, 5jo1:B, 4la7:B, 4lga:B, 3rt0:B, 3ujg:B, 5vr7:B, 5vro:B, 5vsq:B, 5vsr:B, 5vt7:B, 6zuc:B |