GDRCYNCGGLDHHAKECKLPPQPKKCHFCQSISHMVASCPLK
The query sequence (length=42) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2cqf:A | 63 | 42 | 1.0000 | 0.6667 | 1.0000 | 6.43e-27 | |
2 | 2li8:A | 63 | 42 | 1.0000 | 0.6667 | 1.0000 | 9.65e-27 | |
3 | 5udz:A | 139 | 42 | 1.0000 | 0.3022 | 1.0000 | 1.41e-26 | 8ops:B, 8opt:B, 8ost:B, 3trz:A, 3trz:B, 3trz:C, 3trz:D, 3trz:E, 3trz:F, 3ts0:A, 3ts0:B, 3ts2:A, 3ts2:B, 5udz:B |
4 | 2ec7:A | 49 | 40 | 0.3571 | 0.3061 | 0.3750 | 1.08e-04 | |
5 | 2a51:A | 39 | 37 | 0.3810 | 0.4103 | 0.4324 | 0.006 | |
6 | 7s7b:F | 352 | 26 | 0.2143 | 0.0256 | 0.3462 | 0.018 | 7s7b:B, 7s7c:B |
7 | 5w0n:A | 379 | 27 | 0.2143 | 0.0237 | 0.3333 | 0.13 | 5w0m:A, 5w0m:C, 5w0n:B |
8 | 6rwg:A | 157 | 37 | 0.3333 | 0.0892 | 0.3784 | 0.23 | 1a1t:A, 1aaf:A, 1bj6:A, 2buo:A, 1esk:A, 2exf:A, 1f6u:A, 5i1r:A, 2jzw:A, 2l4l:A, 2m3z:A, 1mfs:A, 1q3y:A, 1q3z:A, 7r7p:I, 7r7p:L |
9 | 4v6w:CT | 158 | 22 | 0.2143 | 0.0570 | 0.4091 | 0.54 | 6xu6:CT, 6xu7:CT, 6xu8:CT |
10 | 5w0b:A | 334 | 25 | 0.2143 | 0.0269 | 0.3600 | 0.73 | |
11 | 2bl6:A | 37 | 36 | 0.3095 | 0.3514 | 0.3611 | 1.7 | |
12 | 3nyb:B | 64 | 15 | 0.2143 | 0.1406 | 0.6000 | 2.1 | |
13 | 7c4c:A | 332 | 40 | 0.3333 | 0.0422 | 0.3500 | 2.5 | 7c42:A, 7c43:A, 7c45:A, 7c47:A, 7c4b:A |
14 | 2o4u:X | 331 | 14 | 0.2143 | 0.0272 | 0.6429 | 2.7 | 2poq:X |
15 | 9fmd:U | 295 | 19 | 0.1905 | 0.0271 | 0.4211 | 3.1 | 8c6j:h, 6icz:Z, 6qdv:c, 7w5a:1, 7w5b:1, 5xjc:Z |
16 | 2ihx:A | 50 | 40 | 0.2619 | 0.2200 | 0.2750 | 4.2 | |
17 | 2ihx:A | 50 | 17 | 0.1905 | 0.1600 | 0.4706 | 7.3 | |
18 | 6bk8:O | 229 | 19 | 0.1905 | 0.0349 | 0.4211 | 4.3 | |
19 | 6exn:c | 204 | 19 | 0.1905 | 0.0392 | 0.4211 | 5.2 | |
20 | 2lli:A | 124 | 15 | 0.2143 | 0.0726 | 0.6000 | 6.6 | |
21 | 5m5w:B | 1183 | 34 | 0.2381 | 0.0085 | 0.2941 | 6.6 | 4c2m:B, 4c2m:Q, 4c3h:B, 4c3i:B, 4c3j:B, 5g5l:B, 6h67:B, 6h68:B, 6hko:B, 6hlq:B, 6hlr:B, 5m3f:B, 5m3m:B, 5m5x:B, 5m5y:B, 5m64:B, 5n5y:B, 5n5z:B, 5n60:B, 5n61:B, 5oa1:B, 6rqh:B, 6rql:B, 6rqt:B, 6rrd:B, 6rui:B, 6ruo:B, 6rwe:B, 6tps:B, 5w5y:B, 5w64:B, 5w65:B, 5w66:B, 4ym7:AB, 4ym7:BB, 4ym7:CB, 4ym7:DB, 4ym7:EB, 4ym7:FB |