BioLiP

>protein
GDAEIKGIKPKVIEEYSLGPSNDSWKSLMSSAKDTPLQYDHMNRESLKKYFNPNAQLIEDPLDKPIQYRVCEKCGKPLAL
TAIVDHLE

The query sequence (length=88) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	3mhh:E	92	91	0.9886	0.9457	0.9560	2.70e-59	6aqr:E, 4fip:D, 4fip:H, 4fjc:D, 4fk5:E, 3m99:D, 3mhs:E, 6t9l:N, 4wa6:E, 4zux:Y, 4zux:d, 4zux:i, 4zux:n
2	4w4u:E	84	88	0.9205	0.9643	0.9205	4.25e-54	4fjc:H, 4w4u:H, 4wa6:H
3	2lo3:A	44	37	0.4205	0.8409	1.0000	5.68e-22
4	3mhh:C	93	42	0.1705	0.1613	0.3571	0.051	6aqr:C, 4fk5:C, 3kjl:E, 3kjl:H, 3m99:B, 3mhs:C, 6t9l:M, 4wa6:C, 4zux:W, 4zux:b, 4zux:g, 4zux:l
5	6sg9:Fe	122	22	0.1023	0.0738	0.4091	1.0	6sgb:Fe
6	6z1p:Bw	662	45	0.1477	0.0196	0.2889	1.2
7	6dm6:A	378	62	0.2159	0.0503	0.3065	1.6	6dm6:B, 6ptv:B, 6ptv:C
8	6gjc:A	2770	35	0.1136	0.0036	0.2857	2.4	6gjc:B, 6gjc:C, 6gjc:D, 6gjc:E, 6gjc:F
9	4v8l:D	2822	40	0.1364	0.0043	0.3000	3.0	4ce4:o, 6hiv:US, 6hiv:UT, 6hiw:US, 6hiw:UT, 6hiy:US, 6hiy:UT, 4v8l:E, 4v8l:F, 4v8l:A, 4v8l:B, 4v8l:C, 4v8v:A, 4v8v:B, 4v8v:C, 4v8v:D, 4v8v:E, 4v8v:F, 4v8w:D, 4v8w:E, 4v8w:F, 4v8w:A, 4v8w:B, 4v8w:C
10	2nox:B	266	41	0.1364	0.0451	0.2927	3.6	2nox:A, 2nox:C, 2nox:D, 2nox:E, 2nox:F, 2nox:G, 2nox:H, 2nox:I, 2nox:J, 2nox:K, 2nox:L, 2nox:M, 2nox:N, 2nox:O, 2nox:P
11	3ax6:A	360	69	0.2045	0.0500	0.2609	4.7	3ax6:B, 3ax6:C, 3ax6:D
12	6djk:A	376	52	0.1818	0.0426	0.3077	5.2
13	7kha:I	385	42	0.1818	0.0416	0.3810	6.2
14	2hzs:B	235	33	0.1591	0.0596	0.4242	6.5	2hzs:F, 2hzs:D, 2hzs:H, 3rj1:E, 3rj1:L, 3rj1:S
15	8dfs:I	555	42	0.1818	0.0288	0.3810	7.4	8dej:J, 8dej:K, 8dex:I, 8dfa:I, 8dfa:J, 8dfo:I

[Back]