GASGDVCQDCIQMVTDIQTAVRTNSTFVQALVEHVKEECDRLGPGMADICKNYISQYSEIAIQMMMHMQPKEICALVGFC
D
The query sequence (length=81) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6slr:B | 81 | 81 | 1.0000 | 1.0000 | 1.0000 | 5.08e-57 | 6slr:C, 4v2o:B, 4v2o:C |
2 | 5yvg:A | 830 | 29 | 0.1481 | 0.0145 | 0.4138 | 0.60 | 2h4m:B, 2ot8:B, 5yvh:A |
3 | 8sgh:A | 844 | 29 | 0.1481 | 0.0142 | 0.4138 | 0.60 | 7cyl:A, 4fdd:A, 4fq3:A, 2h4m:A, 5j3v:A, 5j3v:B, 4jlq:A, 4oo6:A, 2ot8:A, 5tqc:A, 7vpw:A, 5yvi:A, 2z5k:A, 2z5m:A, 2z5n:A, 2z5o:A |
4 | 5yvg:B | 764 | 29 | 0.1481 | 0.0157 | 0.4138 | 0.66 | |
5 | 4fb3:A | 115 | 67 | 0.1852 | 0.1304 | 0.2239 | 0.84 | 4fb3:B, 4fb3:E |
6 | 5hdt:A | 1085 | 61 | 0.1852 | 0.0138 | 0.2459 | 1.9 | 5hdt:B |
7 | 1x8d:A | 104 | 32 | 0.1605 | 0.1250 | 0.4062 | 2.6 | 1x8d:B, 1x8d:C, 1x8d:D |
8 | 3mx6:B | 260 | 77 | 0.2099 | 0.0654 | 0.2208 | 2.7 | 3mr1:A, 3mr1:B, 3mr1:C, 3mr1:D, 3mx6:A |
9 | 7wgh:A | 350 | 22 | 0.1358 | 0.0314 | 0.5000 | 3.1 | 7wgi:A |
10 | 3e5p:B | 371 | 19 | 0.1235 | 0.0270 | 0.5263 | 3.9 | 3e5p:A, 3e5p:C, 3e6e:A, 3e6e:C, 3e6e:B |
11 | 1zjc:A | 413 | 22 | 0.0988 | 0.0194 | 0.3636 | 5.1 | |
12 | 8dga:A | 1629 | 42 | 0.1481 | 0.0074 | 0.2857 | 7.0 | |
13 | 8dg5:A | 1635 | 42 | 0.1481 | 0.0073 | 0.2857 | 7.5 | 8dg7:A |
14 | 8dfv:A | 1664 | 42 | 0.1481 | 0.0072 | 0.2857 | 7.5 | |
15 | 5dqr:C | 421 | 18 | 0.1235 | 0.0238 | 0.5556 | 8.4 | 5dqr:A, 5dqr:B, 5dqr:D, 5dqr:E, 5dqr:F |