GAMGTKYAVPDTSTYQYDESSGYYYDPTTGLYYDPNSQYYYNSLTQQYLYWDGEKETYVPAAES
The query sequence (length=64) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 5mf9:A | 64 | 64 | 1.0000 | 1.0000 | 1.0000 | 3.95e-40 | |
2 | 4lem:C | 544 | 45 | 0.2344 | 0.0276 | 0.3333 | 0.49 | 4ihi:A, 4jdc:A, 4lem:A, 4lem:B, 4lem:D, 4lem:F, 4ns3:A, 4ns3:B, 4ns3:C, 4ns3:D, 4ns3:E, 4ns3:F |
3 | 8am6:AAA | 547 | 23 | 0.1562 | 0.0183 | 0.4348 | 1.3 | 8am3:AAA, 8am3:BBB, 8am6:BaB, 8am8:BBB, 8am8:AAA |
4 | 8qxc:H | 221 | 44 | 0.2031 | 0.0588 | 0.2955 | 2.7 | 8qxc:A |
5 | 1bxr:A | 1073 | 20 | 0.1250 | 0.0075 | 0.4000 | 9.9 | 1a9x:A, 1a9x:C, 1a9x:E, 1a9x:G, 1bxr:C, 1bxr:E, 1bxr:G, 1c30:A, 1c30:C, 1c30:E, 1c30:G, 1c3o:A, 1c3o:C, 1c3o:E, 1c3o:G, 1ce8:A, 1ce8:C, 1ce8:E, 1ce8:G, 1cs0:A, 1cs0:C, 1cs0:E, 1cs0:G, 1jdb:B, 1jdb:E, 1jdb:H, 1jdb:K, 1kee:A, 1kee:C, 1kee:E, 1kee:G, 1m6v:A, 1m6v:C, 1m6v:E, 1m6v:G, 1t36:A, 1t36:C, 1t36:E, 1t36:G |