BioLiP

>protein
GAMGPGVDTQIFEDPREFLSHLEEYLRQVGGSEEYWLSQIQNHMNGPAKKWWEFKQGSVKNWVEFKKEFLQYSEG

The query sequence (length=75) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	4x3h:A	79	71	0.9333	0.8861	0.9859	8.30e-48	8qf5:H, 6tno:A, 6tno:C, 6tno:E, 6tnq:A, 6tnq:C, 6tnq:E, 6tq0:A, 6tq0:C, 6tq0:E, 6tq0:G, 6tq0:I, 6tq0:K, 6tq0:M, 6tq0:O, 4x3i:A
2	8hj4:C	130	39	0.2133	0.1231	0.4103	1.6
3	6sl1:A	2652	58	0.2267	0.0064	0.2931	2.0	6sky:A, 6sky:B
4	6iq5:A	459	66	0.3200	0.0523	0.3636	3.1	3pm0:A
5	6et5:3	58	47	0.1867	0.2414	0.2979	3.5	6et5:P, 6et5:S, 6et5:V, 6et5:Y, 6et5:b, 6et5:e, 6et5:h, 6et5:k, 6et5:n, 6et5:q, 6et5:t, 6et5:w, 6et5:z, 6et5:6, 6et5:F, 6et5:K
6	7oik:A	4426	21	0.1200	0.0020	0.4286	3.8	7oim:A, 6tax:A, 6tay:A
7	7vjv:A	221	30	0.1467	0.0498	0.3667	4.6
8	1y9d:D	560	39	0.1467	0.0196	0.2821	5.2	1y9d:A, 1y9d:C
9	4fee:A	586	39	0.1467	0.0188	0.2821	5.5	2ez4:A, 2ez4:B, 2ez8:A, 2ez8:B, 2ez9:A, 2ez9:B, 2ezt:A, 2ezt:B, 2ezu:A, 2ezu:B, 4fee:B, 4feg:A, 4feg:B, 6haf:A, 6haf:B, 4kgd:A, 4kgd:B, 1pow:A, 1pow:B, 1pox:A, 1pox:B, 1y9d:B
10	6due:A	737	47	0.2133	0.0217	0.3404	5.9
11	3s6j:E	220	16	0.0933	0.0318	0.4375	7.7	3s6j:A, 3s6j:B, 3s6j:C, 3s6j:D, 3s6j:F
12	2zja:A	700	43	0.1733	0.0186	0.3023	9.9	2zj5:A

[Back]