GADDDKPIQVTQMPQLAQQFIKQHFSDSKVALAKMESDFLYKSYEVIFTNGNKVEFDKKGNWEEVDCKHTSVPVAIIPAA
IQKYVTTNYPDAKVLKIERDKKDYEVKLSNRTELKFDLKFNLIDIDN
The query sequence (length=127) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 3db7:A | 127 | 127 | 1.0000 | 1.0000 | 1.0000 | 6.97e-92 | |
2 | 6ai9:B | 311 | 92 | 0.1654 | 0.0675 | 0.2283 | 0.22 | 6ai9:A, 6aik:A, 6aik:B, 6aim:A, 6aim:B, 6aip:A, 6aip:B |
3 | 1kqq:A | 131 | 54 | 0.1260 | 0.1221 | 0.2963 | 1.6 | |
4 | 6ywe:B | 326 | 46 | 0.1102 | 0.0429 | 0.3043 | 3.2 | 6yws:B, 6ywv:B, 6ywx:B, 6ywy:B |
5 | 3jcs:Z | 79 | 72 | 0.1260 | 0.2025 | 0.2222 | 4.0 | |
6 | 2gpy:B | 192 | 35 | 0.1024 | 0.0677 | 0.3714 | 4.7 | 2gpy:A |
7 | 6b51:A | 246 | 30 | 0.1024 | 0.0528 | 0.4333 | 7.5 | 6b52:A, 6b53:A, 6b53:B, 6b54:A, 5tiv:A, 5tiw:A, 5tiw:B, 5tix:A, 5tix:B, 5tiy:A, 6uuy:A, 6uuy:B |