FTFASPTQVFFNSANVRQVDVPTQTGAFGILAAHVPTLQVLRPGLVVVHAEDGTTSKYFVSSGSVTVNADSSVQLLAEEA
VTL
The query sequence (length=83) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 4asu:H | 83 | 83 | 1.0000 | 1.0000 | 1.0000 | 4.49e-55 | |
2 | 5fl7:H | 113 | 74 | 0.4096 | 0.3009 | 0.4595 | 4.61e-17 | |
3 | 2jdi:H | 88 | 83 | 0.5060 | 0.4773 | 0.5060 | 2.96e-11 | 2ck3:H, 2w6j:H |
4 | 8ap6:H1 | 161 | 75 | 0.2771 | 0.1429 | 0.3067 | 3.68e-06 | 8ap6:H2, 8ap9:H, 8apa:H1, 8apb:H1, 8apc:H1, 8apd:H1, 8ape:H1, 8aph:H1, 8apj:H1, 8apk:H1 |
5 | 2e5y:A | 133 | 67 | 0.2530 | 0.1579 | 0.3134 | 0.42 | 2e5y:B, 7xkq:H |
6 | 8a5q:U | 606 | 22 | 0.1205 | 0.0165 | 0.4545 | 5.2 | 8a5d:U, 8a5p:U |
7 | 5hkk:H | 132 | 55 | 0.2169 | 0.1364 | 0.3273 | 5.3 | 5hkk:P |
8 | 3dcm:X | 188 | 36 | 0.1446 | 0.0638 | 0.3333 | 6.0 | |
9 | 3gs2:A | 109 | 43 | 0.1687 | 0.1284 | 0.3256 | 6.5 | 3gs2:C |
10 | 9awk:A | 402 | 25 | 0.1084 | 0.0224 | 0.3600 | 7.1 | 9avu:A, 9avu:C, 9avv:C, 9awj:A, 9awj:C, 9awk:C |
11 | 3ele:A | 398 | 23 | 0.1325 | 0.0276 | 0.4783 | 7.4 | 3ele:B, 3ele:C, 3ele:D |
12 | 4yn3:A | 596 | 65 | 0.2651 | 0.0369 | 0.3385 | 7.7 | 3vta:A, 3vta:B |
13 | 7mhs:E | 489 | 24 | 0.1084 | 0.0184 | 0.3750 | 8.2 | |
14 | 3l31:A | 234 | 30 | 0.1325 | 0.0470 | 0.3667 | 9.4 | 3l2b:A, 3l2b:B, 3l31:B |