BioLiP

>protein
FSPVPSPEGTKETYWETKAPSSDVLGIGAGVSSGNFAAASVFAALVGGYCTGQVIPLTVEPNPLFLAGSFLLPYSWALHV
AAWIQKNNGK

The query sequence (length=90) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	8wm6:R	90	90	1.0000	1.0000	1.0000	1.99e-61	8wmj:R, 8wmv:R, 8wmw:R
2	7y7b:R	92	90	0.7889	0.7717	0.7889	5.11e-43	7y8a:R
3	7y5e:RN	78	75	0.3444	0.3974	0.4133	1.43e-10	7y5e:R2, 7y7a:R7, 7y7a:Ro
4	6l4u:2u	89	88	0.3333	0.3371	0.3409	8.91e-07	6ly5:h
5	8jw0:h	132	86	0.3111	0.2121	0.3256	1.74e-05
6	8jze:h	131	29	0.1556	0.1069	0.4828	0.002	8jzf:h
7	8jjr:r	131	29	0.1556	0.1069	0.4828	0.004
8	5fal:A	435	58	0.1778	0.0368	0.2759	2.2	5fan:A, 4kec:A
9	2oi6:B	452	56	0.2000	0.0398	0.3214	2.5	4aa7:A, 4aa7:B, 1fwy:A, 1fwy:B, 1hv9:A, 1hv9:B, 2oi5:A, 2oi5:B, 2oi6:A, 2oi7:A, 2oi7:B, 3twd:A, 3twd:B
10	4fe1:F	141	35	0.1444	0.0922	0.3714	3.9	7fix:F1, 7fix:F2, 7fix:F3, 1jb0:F, 6k33:bF, 6k33:aF, 6k33:cF, 7m75:F, 7m76:F, 7m78:F, 3pcq:F, 6pfy:Q, 6pfy:F, 6pfy:d, 6pgk:Q, 6pgk:F, 6pgk:d, 6tra:F, 6trc:F, 6trc:f, 6trc:6, 6trd:F, 6trd:f, 6trd:6, 5zf0:F1, 5zf0:F2, 5zf0:F3, 5zf0:F4, 5zf0:F6, 5zf0:F5
11	7r8b:B	564	25	0.1222	0.0195	0.4400	6.5
12	4mnp:A	305	38	0.1556	0.0459	0.3684	6.8
13	7r89:B	529	25	0.1222	0.0208	0.4400	7.4
14	6hqb:F	143	66	0.2111	0.1329	0.2879	8.2	8am5:f, 8asl:f, 8asp:f, 4kt0:F, 6nwa:F, 6nwa:f, 6nwa:Q, 5oy0:F, 5oy0:f, 5oy0:6, 7umh:F, 7umh:Q, 7umh:f, 6uzv:F, 6uzv:6, 6uzv:f

[Back]