BioLiP

>protein
FREQDIYLPIANVARIMKNAIPQTGKIAKDAKECVQECVSEFISFITSEASERCHQEKRKTINGEDILFAMSTLGFDSYV
EPLKLYLQKFRE

The query sequence (length=92) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	4awl:B	92	92	1.0000	1.0000	1.0000	1.86e-65	7ah8:A, 7ah8:C, 6qmp:B, 6qmq:B, 6qms:B, 8qu2:B, 8qu3:B, 8qu4:B
2	7aw7:B	92	92	0.7500	0.7500	0.7500	7.44e-50	7aw9:B, 4g91:B, 4g92:B, 6y35:B, 6y36:B, 6y37:B, 6y39:B, 6y39:E, 6y39:H
3	6r2v:B	93	91	0.7174	0.7097	0.7253	1.57e-48	7cvo:B, 7cvq:B, 7cvq:G, 7cvq:L, 7cvq:Q
4	7c9o:B	85	85	0.6304	0.6824	0.6824	1.86e-41
5	1jfi:B	135	85	0.3587	0.2444	0.3882	1.95e-17
6	4wzs:B	113	74	0.2935	0.2389	0.3649	2.07e-10
7	1a7w:A	68	64	0.2500	0.3382	0.3594	2.51e-05	5t5k:A, 5t5k:B, 5t5k:C, 5t5k:D, 5t5k:E, 5t5k:F
8	7aw9:C	118	65	0.2174	0.1695	0.3077	0.017	7aw7:C, 4g91:C, 4g92:C, 6y35:C, 6y36:C, 6y37:C, 6y39:C, 6y39:F, 6y39:I
9	6qmq:C	84	79	0.2609	0.2857	0.3038	0.063	7ah8:B, 7ah8:D, 4awl:C, 6qmp:C, 6qms:C, 8qu2:C, 8qu3:C, 8qu4:C
10	6so9:A	112	35	0.1522	0.1250	0.4000	2.3
11	1yfr:A	448	77	0.2174	0.0446	0.2597	3.3	1yfr:B, 1yfs:A, 1yfs:B, 1ygb:A
12	7d69:D	96	41	0.1522	0.1458	0.3415	3.5	7d69:H
13	7d69:B	78	54	0.1087	0.1282	0.1852	3.9	7d69:F
14	8je1:A	675	56	0.1304	0.0178	0.2143	5.9
15	6kxv:E	95	67	0.1739	0.1684	0.2388	6.3	6kxv:A

[Back]