FQVYYLGNVPVAKPVGVDVINGALESVLSSSSREQWTPSHVSVAPATLTILHQQTEAVLGECRVRFLSFLAVGRDVHTFA
FIMAAGPASFCCHMFWCEPNAASLSEAVQAACMLRYQKCLDARS
The query sequence (length=124) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 3dxd:A | 131 | 124 | 1.0000 | 0.9466 | 1.0000 | 9.28e-91 | 3dxc:A, 3dxc:C, 3dxd:C, 3dxe:A, 3dxe:C |
2 | 6itu:A | 146 | 129 | 0.2339 | 0.1986 | 0.2248 | 3.68e-05 | |
3 | 2nmb:A | 147 | 124 | 0.2984 | 0.2517 | 0.2984 | 1.57e-04 | 1ddm:A, 5yi7:A, 5yi7:C, 5yi8:A |
4 | 7btq:A | 474 | 41 | 0.1290 | 0.0338 | 0.3902 | 0.33 | 7btq:D |
5 | 3gh6:A | 209 | 71 | 0.1613 | 0.0957 | 0.2817 | 0.56 | |
6 | 3d8f:A | 127 | 76 | 0.1452 | 0.1417 | 0.2368 | 1.2 | 3d8f:C |
7 | 3so6:A | 137 | 102 | 0.1774 | 0.1606 | 0.2157 | 1.2 | |
8 | 6ueb:A | 2099 | 75 | 0.1613 | 0.0095 | 0.2667 | 2.1 | |
9 | 8ras:C | 726 | 28 | 0.0645 | 0.0110 | 0.2857 | 2.5 | |
10 | 1j49:A | 332 | 94 | 0.2016 | 0.0753 | 0.2660 | 3.2 | 1j49:B |
11 | 6sga:DU | 219 | 32 | 0.0887 | 0.0502 | 0.3438 | 5.8 | 6hiv:DU, 6hiw:DU, 6hiy:DU, 7pua:DU, 7pub:DU, 6sgb:DU |
12 | 4cog:A | 207 | 63 | 0.1371 | 0.0821 | 0.2698 | 6.0 | 4cog:B, 4cog:C, 4cog:D |
13 | 8wa0:B | 973 | 28 | 0.0645 | 0.0082 | 0.2857 | 6.5 | 8w9z:B |
14 | 8wa1:B | 998 | 28 | 0.0645 | 0.0080 | 0.2857 | 6.5 |