FPEVVELNVGGQVYFTRHSTLISIPHSLLWKMFSLAKDSKGRFFIDRDGFLFRYILDYLRDRQVVLPDHFPEKGRLKREA
EYFQLPDLVKLLT
The query sequence (length=93) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6ocp:B | 99 | 96 | 1.0000 | 0.9394 | 0.9688 | 3.36e-62 | 6m8r:A, 6m8r:F, 6ocp:C, 6ocp:D, 6ocp:E, 6ocp:F, 6ocp:G, 6ocp:H, 6ocp:K, 6ocp:L, 6ocp:M, 6ocp:N |
2 | 6sga:FS | 277 | 66 | 0.2688 | 0.0903 | 0.3788 | 1.00e-04 | 6sga:FQ, 6sga:FR, 6sga:FU, 6sgb:FQ, 6sgb:FR, 6sgb:FU |
3 | 2i2r:L | 138 | 68 | 0.2581 | 0.1739 | 0.3529 | 5.15e-04 | 2i2r:A, 2i2r:C, 2i2r:D, 2i2r:I, 2i2r:J, 2i2r:K, 2nz0:B, 2nz0:D, 1s1g:A, 1s1g:B |
4 | 2i2r:B | 124 | 68 | 0.2581 | 0.1935 | 0.3529 | 5.70e-04 | |
5 | 7e8e:D | 459 | 69 | 0.2366 | 0.0479 | 0.3188 | 0.006 | 7e87:B, 7e87:A, 7e87:C, 7e87:D, 7e8e:B, 1nn7:A, 7ukg:A, 7ukg:B, 7ukg:C, 7ukg:D |
6 | 7ukh:A | 203 | 71 | 0.2473 | 0.1133 | 0.3239 | 0.019 | 7ukh:B, 7ukh:C, 7ukh:D |
7 | 8quc:A | 395 | 72 | 0.2473 | 0.0582 | 0.3194 | 0.18 | 8f1c:A, 8f1c:B, 8f1c:C, 8f1c:D, 8f1d:A, 8f1d:B, 8f1d:C, 8f1d:D, 7phi:C, 7phi:B, 7phi:D, 8quc:B, 8quc:D, 8quc:C, 8qud:A, 8qud:B, 8qud:C, 8qud:D |
8 | 1t3q:B | 786 | 35 | 0.1505 | 0.0178 | 0.4000 | 0.42 | 1t3q:E |
9 | 3d7t:A | 249 | 60 | 0.1398 | 0.0522 | 0.2167 | 0.63 | 1byg:A |
10 | 8osg:F | 258 | 88 | 0.2796 | 0.1008 | 0.2955 | 2.6 | |
11 | 4ttb:A | 189 | 18 | 0.0860 | 0.0423 | 0.4444 | 7.3 | 4ttb:B |
12 | 5juy:B | 1234 | 35 | 0.1720 | 0.0130 | 0.4571 | 8.3 | 1cy5:A, 3j2t:A, 3j2t:B, 3j2t:C, 3j2t:D, 3j2t:E, 3j2t:F, 3j2t:G, 3jbt:A, 3jbt:C, 3jbt:E, 3jbt:G, 3jbt:I, 3jbt:K, 3jbt:M, 5juy:A, 5juy:C, 5juy:D, 5juy:E, 5juy:F, 5juy:G, 2p1h:A, 5wve:A, 5wve:C, 5wve:E, 5wve:G, 5wve:I, 5wve:K, 5wve:M, 1z6t:A, 1z6t:B, 1z6t:C, 1z6t:D |
13 | 4ttc:A | 220 | 18 | 0.0860 | 0.0364 | 0.4444 | 9.1 | 4ttc:B, 4ttc:C, 4ttc:D, 4ttc:E, 4ttc:F, 5yak:A, 5yak:F, 5yak:B, 5yak:C, 5yak:D, 5yak:E |
14 | 6t2o:BBB | 242 | 27 | 0.0753 | 0.0289 | 0.2593 | 9.9 | 6t2o:AAA, 6t2p:AAA, 6t2p:BBB, 6t2q:AAA, 6t2q:BBB |
15 | 8iuf:C1 | 495 | 30 | 0.1398 | 0.0263 | 0.4333 | 9.9 | 8iuj:c1, 8iuj:C1 |