FHLTTRNGEPHMIVSRQEKGKSLLFKTEDGVNMCTLMAMDLGELCEDTITYKCPLLRQNEPEDIDCWCNSTSTWVTYGTC
T
The query sequence (length=81) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 3c6e:C | 81 | 81 | 1.0000 | 1.0000 | 1.0000 | 1.12e-57 | 5u4w:B, 5u4w:D, 5u4w:F |
2 | 7qrf:D | 80 | 70 | 0.2716 | 0.2750 | 0.3143 | 8.02e-09 | |
3 | 5npi:B | 233 | 35 | 0.1481 | 0.0515 | 0.3429 | 1.6 | 5npi:A, 5npj:A, 5npj:B |
4 | 5j67:C | 563 | 49 | 0.2222 | 0.0320 | 0.3673 | 3.1 | 5j67:A, 5j68:A |
5 | 6b5n:H | 222 | 35 | 0.1852 | 0.0676 | 0.4286 | 5.5 | 6b5l:H, 6b5m:H, 6b5o:H, 7rd3:A, 7rd3:H, 7sg5:H, 7sg6:H |
6 | 8qa8:B | 202 | 69 | 0.2099 | 0.0842 | 0.2464 | 6.4 | 8qa8:A, 8qa8:C, 8qa8:D, 8qa8:E, 8qa8:F, 1r71:A, 1r71:B, 1r71:C, 1r71:D |
7 | 4d62:A | 138 | 13 | 0.0988 | 0.0580 | 0.6154 | 7.0 | 4d63:A |
8 | 4g0a:A | 312 | 38 | 0.1605 | 0.0417 | 0.3421 | 8.0 | 6cy9:A, 4g0a:B, 4g0a:C, 4g0a:D, 2r7p:A, 2r8f:A |
9 | 2q6f:B | 295 | 27 | 0.1358 | 0.0373 | 0.4074 | 8.5 | 2q6f:A |
10 | 7e0l:A | 491 | 26 | 0.1358 | 0.0224 | 0.4231 | 9.6 | 7e0l:B, 7e0l:K, 7e0l:M, 7wsx:A, 7wsx:B |
11 | 3ngj:D | 222 | 40 | 0.1235 | 0.0450 | 0.2500 | 10.0 | 3ngj:A, 3ngj:B, 3ngj:C |