Home Research COVID-19 Services Publications People Teaching Job Opening News Forum Lab Only
Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

BioLiP
>protein
FERDWLRTDLNVIGFGLIGWLAPSSIPAINGNSLTGLFFSSIGPELAHFPTGPAVTSPFWLWMVLWHLGLFLTLTFGQIG
FKGRSEGYF

The query sequence (length=89) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

# Hit Hit
length 		Aligned
length 		Identity
(normalized by query) 		Identity
(normalized by hit) 		Identity (normalized
by aligned length) 		E-value Homologs
to hit
1 8wgh:O 89 89 1.0000 1.0000 1.0000 1.43e-59
2 8htu:O 90 88 0.8090 0.8000 0.8182 9.60e-50 7ksq:O, 7ku5:O, 7xqp:O
3 8j6z:O 86 85 0.8090 0.8372 0.8471 1.52e-47
4 5zji:O 76 89 0.6517 0.7632 0.6517 2.95e-34
5 7dz7:O 97 90 0.5618 0.5155 0.5556 1.04e-28 7d0j:O, 7dz8:O
6 6sl5:O 86 86 0.5169 0.5349 0.5349 1.21e-25
7 7yca:O 96 92 0.4494 0.4167 0.4348 4.80e-24
8 6zzx:O 87 75 0.4494 0.4598 0.5333 1.04e-20
9 7y5e:ON 92 78 0.4157 0.4022 0.4744 2.04e-19 7y5e:O2, 7y7a:O7, 7y7a:Oo
10 6fos:O 98 79 0.4157 0.3776 0.4684 5.52e-19 7blz:O, 8wey:O, 5zgb:O, 5zgh:O
11 7y7b:O 99 87 0.4045 0.3636 0.4138 3.57e-15 7y8a:O
12 8wm6:O 104 72 0.3596 0.3077 0.4444 5.83e-15 8wmv:O, 8wmw:O
13 7vb3:B 414 52 0.2022 0.0435 0.3462 0.001 7vb3:A, 7vb3:C, 7vb3:D, 7vb5:A, 7vb5:B, 7vb5:C, 7vb5:D, 7vb6:A, 7vb6:B, 7vb6:C, 7vb6:D
14 7nac:x 539 28 0.1348 0.0223 0.4286 0.12 7nad:x, 7r72:x, 7r7a:x
15 5a8r:B 442 46 0.1798 0.0362 0.3478 3.5 5a8r:E, 5a8r:H, 5a8r:K, 5a8w:B, 5a8w:E, 5a8w:H, 5a8w:K

[Back]
Reference:
  • Chengxin Zhang, Xi Zhang, Peter L Freddolino, and Yang Zhang. BioLiP2: an updated structure database for biologically relevent ligand-protein interactions, Nucleic Acids Research, gkad630 (2023)(download the PDF file).
  • Jianyi Yang, Ambrish Roy, and Yang Zhang. BioLiP: a semi-manually curated database for biologically relevant ligand-protein interactions, Nucleic Acids Research, 41: D1096-D1103 (2013) (download the PDF file).

    • zhanglabzhanggroup.org | +65-6601-1241 | Computing 1, 13 Computing Drive, Singapore 117417