Home Research COVID-19 Services Publications People Teaching Job Opening News Forum Lab Only
Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

BioLiP
>protein
FEGFYKLIMRRNSVYVTFIIAGAFFGERAVDYGVHKLWERNNVGKRYEDISVLGQRP

The query sequence (length=57) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

# Hit Hit
length 		Aligned
length 		Identity
(normalized by query) 		Identity
(normalized by hit) 		Identity (normalized
by aligned length) 		E-value Homologs
to hit
1 8bel:I 57 57 1.0000 1.0000 1.0000 1.37e-37 8bel:S, 8bpx:AI, 8bpx:BI, 8bq5:AI, 8bq5:BI, 8bq6:AI, 8bq6:BI
2 8e73:V 59 56 0.8070 0.7797 0.8214 3.80e-31 8e73:J
3 1be3:J 62 47 0.3333 0.3065 0.4043 1.91e-06 1bgy:J, 1bgy:V, 7dkf:J1, 7dkf:V1, 5luf:j, 5luf:v, 5nmi:W, 5nmi:J, 1sqp:J, 2ybb:j, 2ybb:J
4 5xte:D 62 47 0.3158 0.2903 0.3830 2.44e-05 5xte:Q, 5xth:AD, 5xth:AQ, 5xti:AD, 5xti:AQ
5 1iyb:A 208 19 0.1754 0.0481 0.5263 0.22 1iyb:B
6 5fgn:A 536 53 0.2632 0.0280 0.2830 0.55 4kav:A, 4kay:A, 4kay:B
7 1h2b:B 344 44 0.2807 0.0465 0.3636 1.4 1h2b:A
8 4twe:A 706 32 0.2456 0.0198 0.4375 5.8 4twe:B
9 2cy2:A 174 20 0.1579 0.0517 0.4500 6.0
10 5xdc:B 402 18 0.1754 0.0249 0.5556 6.2 5xdb:A, 5xdb:B, 5xdb:C, 5xdb:D, 5xdc:A, 5xdc:C, 5xdc:D, 5xdd:A, 5xdd:B, 5xdd:C, 5xdd:D, 5xde:A, 5xde:B, 5xde:C, 5xde:D, 5xdg:A, 5xdg:B, 5xdg:C, 5xdg:D
11 8auv:G 83 34 0.1404 0.0964 0.2353 7.4 8b2l:G1

[Back]
Reference:
  • Chengxin Zhang, Xi Zhang, Peter L Freddolino, and Yang Zhang. BioLiP2: an updated structure database for biologically relevent ligand-protein interactions, Nucleic Acids Research, gkad630 (2023)(download the PDF file).
  • Jianyi Yang, Ambrish Roy, and Yang Zhang. BioLiP: a semi-manually curated database for biologically relevant ligand-protein interactions, Nucleic Acids Research, 41: D1096-D1103 (2013) (download the PDF file).

    • zhanglabzhanggroup.org | +65-6601-1241 | Computing 1, 13 Computing Drive, Singapore 117417