BioLiP

>protein
FEETHLTSLDPVKQFAAWFEEAVQCPDIGEANAMCLATCTRDGKPSARMLLLKGFGKDGFRFFTNFESRKGKELDSNPFA
SLVFYWEPLNRQVRVEGPVKKLPEEEAECYFHSRPKSSQIGAVVSHQSSVIPDREYLRKKNEELEQLYQDQEVPKPKSWG
GYVLYPQVMEFWQGQTNRLHDWIVFRRGLPTPLGPMTHRGEEDWLYERLAP

The query sequence (length=211) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	1nrg:A	213	213	0.9905	0.9812	0.9812	9.18e-156	6h00:A, 3hy8:A, 8qyt:A, 8qyw:A
2	1jnw:A	214	202	0.3886	0.3832	0.4059	3.38e-45	1dnl:A, 1g76:A, 1g77:A, 1g78:A, 1g79:A, 6ylz:AAA, 6ymh:BBB
3	1ci0:A	205	215	0.3934	0.4049	0.3860	2.81e-41	1ci0:B
4	1t9m:A	204	187	0.2796	0.2892	0.3155	1.39e-27	1t9m:B
5	4hmw:B	205	178	0.2749	0.2829	0.3258	2.23e-25	4hmw:A, 4hmx:A, 4hmx:B
6	4hmt:B	207	187	0.2701	0.2754	0.3048	1.23e-24	4hms:A, 4hms:B, 4hmt:A, 4hmu:A, 4hmu:B, 4hmv:A, 4hmv:B, 1ty9:A, 1ty9:B
7	1wv4:A	162	202	0.2796	0.3642	0.2921	1.45e-20	1wv4:B, 6ymh:AAA
8	2i51:A	194	79	0.1043	0.1134	0.2785	1.07e-05	2i51:B
9	6s6b:K	1024	111	0.1280	0.0264	0.2432	1.3	6s8b:K, 6s8e:K, 6s91:K, 6sh8:K, 6shb:K, 6sic:K
10	7d0j:6	230	92	0.0948	0.0870	0.2174	6.7	7bgi:6, 7blx:6, 7dz7:6, 7dz8:6, 8h2u:6, 6ijj:6, 6ijo:6, 6jo5:6, 6jo6:6, 7r3k:6, 7wyi:6, 7wzn:6, 7zq9:6, 7zqc:6, 7zqd:6, 7zqd:62
11	5itd:A	995	31	0.0427	0.0090	0.2903	7.4	5dxh:A, 8ilr:A, 8ils:A, 8ilv:A, 7k6m:A, 7k6o:A, 7r9v:A, 7r9y:A, 8sbc:A, 8sbj:A, 8twy:A, 7tz7:A, 5xgj:A

[Back]